KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2223Help
Entry
SYNGTS_2223       CDS       T02098                                 

Gene name
slr0007
Definition
(GenBank) hypothetical protein
  KO
K15669  
D-glycero-alpha-D-manno-heptose 1-phosphate guanylyltransferase [EC:2.7.7.71]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Lipopolysaccharide biosynthesis
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    SYNGTS_2223 (slr0007)
Enzymes [BR:syy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.71  D-glycero-alpha-D-manno-heptose 1-phosphate guanylyltransferase
     SYNGTS_2223 (slr0007)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2474836..2475597
Genome map
AA seq 253 aa AA seqDB search
MALSPADVTVVILAGGFGTRIKQQLPDLPKPLAPVAGQPFLDWQLRYLQQQGFRRSLLST
GYLAEKVAAYAQDADIVDMAIACVAEMEPLGTAGGFVNAVNHHGFRELTPAWLVLNGDSL
IVTDYRVLLAELEDDSVDGVILGVHVPDASRFGSLKVNSQGELLQFAEKQAGAGVINSGV
YLLGDRLLARFPAHRPLSFEYDVFPTLLAQGAKIKVHAVEAPFLDIGTPETLAQAGEFIQ
SLGTLNRIQDLDK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggctctttcccccgcagacgttaccgtggtcattttggctgggggctttggcacccgc
attaagcaacagttaccagatttgcctaaacccttagctcccgtggcgggccaacctttt
ttagattggcaattgcgctatctacaacagcagggttttcggcgatcgctcctttctacg
ggttatctggcagaaaaagtggcggcctatgctcaagatgccgatattgttgacatggcg
atcgcctgtgtggcggaaatggaaccgttgggaacagcggggggatttgtcaatgcggtt
aatcaccatggttttagagaactaacaccggcttggctcgtgcttaacggcgactcgtta
attgtgacggattatcgggttctgttggcggagttagaggatgacagcgttgatggggta
attttgggcgttcatgtgcccgatgcttcccgttttggctccttaaaggttaatagtcaa
ggggaattgctacaatttgcagaaaagcaagccggagccggcgtgattaatagtggggtt
tatctccttggcgatcgcctgttggcccggtttcccgcccacagacccttaagttttgag
tatgatgtgttccccacattgttggcccagggagccaaaatcaaagtccatgctgtggaa
gctccctttttagatattggcaccccggaaacattagcccaggcgggggaatttatccaa
tccctcggtacgttgaaccgaattcaagacctagacaaatag

DBGET integrated database retrieval system