KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2224Help
Entry
SYNGTS_2224       CDS       T02098                                 

Gene name
ctpA
Definition
(GenBank) carboxyl-terminal processing protease
  KO
K03797  
carboxyl-terminal processing protease [EC:3.4.21.102]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
Enzymes [BR:syy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.102  C-terminal processing peptidase
     SYNGTS_2224 (ctpA)
Peptidases [BR:syy01002]
 Serine Peptidases
  Family S41: C-terminal processing peptidase family
   SYNGTS_2224 (ctpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2475669..2476952
Genome map
AA seq 427 aa AA seqDB search
MGKRTRRFWALAFSLLMGALIYLGNTPSALAFTEEQKLLLQSWRLVNQSYLDETFNHQNW
WLLREKYVKRPLRNREETYTAIEEMLATLDEPFTRLLRPEQYGNLQVTTTGELSGVGLQI
NINPETNQLEIMAPLAGSPAEEAGLQPHDQILAIDGVDTQTLSLDEAAARMRGPKNTKVS
LEILSAGTEVPQEFTLTRQLISLSPVAAQLDDSRPGQSVGYIRLSQFSANAYKEVAHALH
QLEEQGADGYILDLRNNPGGLLQAGIDIARLWLPESTIVYTVNRQGTQESFTANGEAATD
RPLVVLVNQGTASASEILAGALQDNQRATLVGEKTFGKGLIQSLFELSDGAGIAVTVAKY
ETPQHHDIHKLGIMPDEVVEQPLISFAEITSPADVQYQAALDLLTGGVAIAHKSSSIPAM
ATAHKPN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaacggacaaggcggttttgggctttagctttttctttgctgatgggggccctg
atttatctgggcaatacaccgtcggccttggctttcaccgaggaacaaaagctactgttg
caatcctggcgtttggtcaaccaatcctatctcgatgaaacctttaaccatcaaaattgg
tggctgttgcgggagaagtacgttaaacgtcccctccggaaccgggaagaaacctacacg
gcgatcgaagaaatgctcgctaccctggatgaaccctttacccgcttactgcgtccggaa
cagtacggcaatctccaggtgaccaccactggtgagctatcgggggtaggtctgcaaatc
aacatcaaccctgaaaccaaccagttagaaattatggcccccctggccggttcccctgcg
gaggaggccgggctgcaaccccatgaccaaattttggcgatcgacggtgtagatacccaa
accctgagcttagacgaagcagcggccagaatgcggggcccaaaaaacaccaaagtttcc
ctggaaattctgtcagcgggcaccgaagtaccccaagaatttaccctgactcggcagtta
atttccctcagtccggtggcggcccaattggacgattcccgcccaggtcaatcggtgggt
tacattcgcctcagtcaatttagtgccaatgcctataaagaagtagcccacgctctgcat
caacttgaggaacagggggccgacggttatatcttggatttgcgtaacaaccccggtggc
ttactccaggctggtattgacattgctcggttgtggttaccggaaagcaccattgtctac
accgttaatcgccaaggcacccaggaaagtttcactgccaatggagaagcggcgaccgat
cgcccgttggtggtgttggtcaaccagggtactgccagtgccagcgaaattttagccgga
gctttgcaggataatcagcgggccactctagtgggggaaaaaacctttggtaagggtttg
attcaatccttgtttgaactatccgatggggccggcattgccgtcacggtggccaaatac
gaaaccccccaacatcacgacatccataaactgggcattatgcccgatgaagtggtggag
caacccctgattagctttgcggaaattacttcccccgccgatgtgcaataccaagccgcc
ttagatttgctcaccggaggagtggcaatcgcccataaatcttcttcaattcccgccatg
gcaacggctcacaagcccaactaa

DBGET integrated database retrieval system