KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2230Help
Entry
SYNGTS_2230       CDS       T02098                                 

Gene name
sll0012
Definition
(GenBank) transposase
  KO
K07492  
putative transposase
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2481559..2482344)
Genome map
AA seq 261 aa AA seqDB search
MIIREFYSTDITDSQWQLVEPHLPKAKTGGRKRKTSLREILNAIFYMLRTGCAWRLLPHD
FPKWRTVYGYFQPWHEDGTWKKLNRIFREKVRLKAGRNTHPSAGCLDSQSLKKAGTGQET
GYDGGKKVNGRKRTILVDTMGLLLDVVVHGAHRSDHQGLILLATWFAPLWQCLQVIWTDS
TFGGKDFIYWVEHTFGWNLNVVSKKQGQKGFEVLPRRWVVERTFAWFGRYRRLSKDYEYL
PTTSETMLYVAMVHLMLQRLA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgataattcgagaattttacagcacggacatcacagatagccagtggcaattggtagaa
cctcatttacccaaagcaaaaactgggggaagaaaacggaaaactagtctgcgggagata
ctcaatgctattttttacatgctcagaacggggtgtgcctggcgacttctgccccatgat
tttcctaaatggcgaacggtctatggttatttccagccatggcacgaagatggtacctgg
aaaaaattaaaccgtatcttccgtgagaaagttcggctcaaagctggaagaaatactcac
cctagtgccggttgtttagattcacagtcacttaaaaaggctggaactggccaagaaact
ggctatgacggcggaaaaaaggtcaatggtcgtaaacgtacaatcctcgtggataccatg
ggattacttctcgatgttgtcgtccatggtgcccatcgctccgaccatcagggtctgatt
ctacttgctacctggtttgctcccctttggcagtgcctgcaagttatatggactgatagc
acctttggcggaaaggattttatctattgggtggagcatacttttggttggaatttgaat
gtcgtcagcaaaaagcagggacaaaaaggttttgaagtcttaccccgccgttgggtagtc
gagcgcacctttgcttggtttggtcgctatcgtcgtttaagcaaggattatgaatattta
cctaccaccagtgagaccatgctctatgttgccatggttcatctcatgcttcaaaggctt
gcttaa

DBGET integrated database retrieval system