KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2231Help
Entry
SYNGTS_2231       CDS       T02098                                 

Gene name
lpxB
Definition
(GenBank) lipid A disaccharide synthase
  KO
K00748  
lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    SYNGTS_2231 (lpxB)
Enzymes [BR:syy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     SYNGTS_2231 (lpxB)
Glycosyltransferases [BR:syy01003]
 Polysaccharide
  Bacterial polysaccharide
   SYNGTS_2231 (lpxB)
Lipopolysaccharide biosynthesis proteins [BR:syy01005]
 Lipid A
  SYNGTS_2231 (lpxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2482459..2483643
Genome map
AA seq 394 aa AA seqDB search
MRIFISTGEVSGDLQGSLLVGALRQQAEEQNLELELVGLGGEKMAAAGLTLLANTAAIGS
VGLTESLRFIIPTWQIQQRVKRYLKTNPIDLLVLIDYMGPNLTIANYLRKTYPNLPILYY
IAPQAWVWSPTKRETAQIMAVTDRLLAIFPGEAEFFQKQGLDVTWVGHPLLDRITKEAPS
RGSAREKLGIDHNETVITLLPASRIQELRYLLPSICGAAQQLQSQLPNVKLLLPVSLKDY
QPQIEQTLKEFNLTVQLLEGKETLTAIAAADLAITKSGTVNLEIALLNVPQVILYRVSPL
TMAIARRIFKFNLPFVSPTNIVLNRGIMPELLQEQATASNIAQAGLELLLNGDRQAKIAQ
DYQELREALGEPGVCERAAQAVLEFANGQQKSRA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatatttattagcacgggggaagtttccggagatttgcaaggatctctgctggtc
ggagcattaagacagcaagctgaagagcaaaacttagaattggaactggtgggtttgggg
ggagaaaaaatggccgctgccggtctgacgttgctggccaatacggcggcgatcggctct
gtgggcttgacggagtccctgcggtttattattcccacttggcagattcaacaacgggtt
aaacgttatttaaaaactaatcccattgatttgttagtcttgattgattacatgggaccc
aatttaaccattgctaattatttacggaaaacctatcccaatctgccaattttgtactat
atcgccccccaggcctgggtgtggtcccccacgaaaagggaaacggcccagattatggcg
gtaaccgatcgcctgttggccatttttccaggggaagcggaatttttccaaaaacaaggt
ttggatgtgacctgggtgggccatcccttgttagaccgcattaccaaggaggcccccagt
cgagggtcagcccgtgaaaagttaggcattgaccataacgaaacggtaattaccctccta
cccgcttcccgcattcaggaactgcgttacctgttgccgtccatttgtggtgccgcccaa
caattgcagagccaattacccaatgtaaaactgctgttgcccgtttcccttaaggattat
caacctcaaatcgaacaaaccctcaaggaatttaatctcacggtgcaactgttggaaggg
aaagaaacgctgacggcgatcgccgcggctgatttggccatcaccaagtcgggaacggtg
aatctggaaattgctttactaaatgtgccccaggttatcctttatcgggttagtcctttg
accatggcgatcgccagacggatttttaaatttaatctacccttcgtttcccctaccaac
attgtgctcaaccggggcattatgccggaactactccaggaacaggccaccgccagcaac
attgcccaagctggattggaattgcttctaaacggcgatcgccaagcaaaaattgcccag
gattaccaagaattaagggaagcattaggggaaccgggggtatgtgagcgagccgcccag
gctgtcttggagtttgccaatgggcaacaaaaaagcagggcttaa

DBGET integrated database retrieval system