KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2233Help
Entry
SYNGTS_2233       CDS       T02098                                 

Gene name
slr0016
Definition
(GenBank) hypothetical protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2484462..2485010
Genome map
AA seq 182 aa AA seqDB search
MYDDDQRRDRRLPLAPLERRGYGYLLDFVVIWLFSSLATGWVQLLIFLVGWFALRVVLVS
ANQGQSLGGWAFDTRVVHLKMKRLPGILELSQREGILGAASYLAMVGLNINFANGVSFLL
LVAPLFGDLIWAIAEDGLGQAFHDRVAGTVVLSSRRGFSLDLRLKKFWFDLKKQWDNRQR
RR
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacgacgaccagcgccgcgatcgccgcttacccctggccccattggaacggcga
ggctatggctacctgttggattttgtcgtgatttggttattcagcagtttagctacgggt
tgggtccagctactaatttttttggttggttggtttgccctgagggtagttttagtgtcc
gctaaccaggggcaaagtttggggggctgggctttcgacactagggtggtacacctgaaa
atgaaacgtttaccgggcattttggaactgagtcaacgggaaggtattttgggggctgcc
tcctacctagccatggtgggtttaaacatcaactttgccaatggggtaagttttttgctt
ttggtggctcccctgtttggagatttaatctgggcgatcgccgaggatggtctgggacaa
gcgttccatgaccgggttgccgggacagtagtgttgagcagtcggcgtggtttttccctc
gatctgaggctaaaaaagttttggtttgacctgaaaaaacaatgggacaatcgacaaaga
agacggtaa

DBGET integrated database retrieval system