KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2234Help
Entry
SYNGTS_2234       CDS       T02098                                 

Gene name
murZ
Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:syy00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:syy00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2485423..2486739
Genome map
AA seq 438 aa AA seqDB search
MLQVATPTATEETQTVIEIEGRASLKGEVRISGAKNSALAIMAGTILCSDDCRLSNLPAL
ADIDKMCQILAAIGVNLERDGDRLVVDSSNVGHGPAPYELVSQLRASFFVIGPLLSRLGM
TKVPLPGGCAIGTRPVDLHVRGLQAMGADVHIEHGVVNASIKGHSRRLTGAKIYLDYPSV
GATETILMAATLAEGETVIDNAAREPEIVDLANFCRSMGAQIRGDGSSRIIINGVEKLHS
TDFPIIPDRIEAATFLCAGAITHSEISLFPVVPDHLASAIAKLREIGPEVAIDAPDRVRL
IPRDLRGTDIETLPYPGFPTDMQAQFMALLAVSEGNSVVTETVFENRLQHVAELQRMGAN
IKLKGNAAFIQGVPFLSGAPVMSTDLRASAALVIAGLAAEGKTIVQGLRHLDRGYEDIEG
KLRKLGAKLTRIEQPVTL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgcttcaagttgctactcctaccgctaccgaagaaacccagacggtcattgaaattgaa
ggccgggcctccctaaaaggggaagttcgcatcagtggggctaaaaattccgctttggcc
atcatggccggcaccatcctttgttccgacgactgtcgtcttagtaatctgcccgctctg
gcggatattgacaaaatgtgccaaattttggcggccattggggtcaatctagaacgggat
ggcgatcgcctcgtagtggattccagtaatgtgggccatggccctgccccctatgagtta
gtgtcccaactgcgggctagctttttcgtcattggccctttactgtcccgtttaggcatg
accaaagtacccctgcctgggggatgcgccattgggactcggcccgttgatctccatgtg
cggggtttgcaggccatgggagcagacgttcacatcgagcatggggtagtcaatgccagc
atcaagggccacagccgtcgtttgaccggagctaaaatttatctggattatcccagcgta
ggggccacggaaactatcctcatggccgccaccctagcggaaggagaaacagtaattgat
aacgccgcccgggaaccggaaattgttgatttggccaacttctgccgttccatgggagcc
caaatccggggggatggttctagccgcattattatcaacggggtggaaaaactccacagc
accgactttcccattattcctgatcgcattgaggccgctacgttcctctgtgccggggcc
atcacccattccgaaattagtcttttccctgtggtgccagatcacctcgcctccgccatt
gccaagttgcgggaaattggccccgaagtggcgatcgatgccccggatcgggtgcgtttg
attccccgggatctgcgggggacagatatcgaaactttgccttaccccggttttcccacc
gatatgcaagcccaattcatggccctgttggcagtgagtgagggtaatagcgtagtcacg
gaaaccgtatttgaaaaccgtctccagcacgtagcggagttacagcggatgggggccaac
attaagctcaaaggtaatgccgcctttatccaaggagtgcctttcctttccggtgcgccg
gtcatgtccacggatttacgagcttcggcggccctggtaattgcggggttagcggcggaa
ggcaaaaccattgtccaaggtctgcgccatttagaccggggttatgaggacattgaaggc
aaactgcgcaaactgggggctaagttaaccaggattgaacagcccgtcactctttaa

DBGET integrated database retrieval system