KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2237Help
Entry
SYNGTS_2237       CDS       T02098                                 

Gene name
slr0019
Definition
(GenBank) hypothetical protein
  KO
K07347  
outer membrane usher protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
Transporters [BR:syy02000]
 Other Transporters
  Pores ion channels [TC:1]
   SYNGTS_2237 (slr0019)
Secretion system [BR:syy02044]
 Chaperone-usher system
  Type 1 pilus assembly protein
   SYNGTS_2237 (slr0019)
Bacterial motility proteins [BR:syy02035]
 Pilus system
  Fimbrial proteins
   SYNGTS_2237 (slr0019)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2489142..2491820
Genome map
AA seq 892 aa AA seqDB search
MVFRFPSPVLVIILANCLMTVVGLILPQSARTETFSADFPPPDSALDLLLGQETPLMETT
IPEPEQGQEDNQSAPPSEPTPGNLGNEDDLFERVFGRPRPTGVQRLVAPFFINDLQQGQI
VVFVSLGGGSSLQITASTLLLKMEEYARPDIQTRLADLVDDSGNLTLAALQSVGLDATFN
DQLLELRIIIPPNLRKTIVYGSGNLQLPPGAATALRPSNFSGFINLIGTQPYAWDGTGDL
GRQALNLGVEGALNYQGWVLEGSASFAEQSNNPWTRSDIRLVKDDPDNAVRYVLGDLFST
ARSYQSFVPMVGFAMFRNFSLQPYLTTRPTGQFEFLLESPARVEIFVNGLLRQTLQLPAG
PQDIRNFGLNTGLNNVTVKIIDSAGRVEELSFSAPLATDLLAVGLNQFGLGVGVPAYTTN
GVRSYDTSRPIIGGFYRQGITSTLTLGGYLQAAGSQQLIGTEGTLATSVGNFGWDAALEN
DGNGLDHAFRLRYQFLALGGNQAQLPNFGLEVEYLGPYFQRFGSFPIGFTAEPLDFFGTT
TNNVSWSFGANYSQTLIDGLGINLGLGYQLGSFGQPNAYRAAIGFTTNLGRGLQANLTLN
NRLDQSGRAETQVLFNFLQTSQFQSLTARSNLSSQREQASTLTWTSRSPAQYNSVNTSVN
LSNNPNPGYFGTGLGLTYRGFLGDINLNHDYDQASHRTNLNFGTALVYADGRFGWSRPVR
DSFVIFSRNPNFADQLVLINPGLYGPVAEANDVGPGVVPDLSSYTLTTMRVDAPNMPLGY
DLGNAVFNLLPSYKSGTLITVGTESTVFLRGTLVDKAGNPIALQVGQVRSLSDPSWSPLE
LFTNRAGRFALTGLGPGKYELQLFGDPPRAIRFEIPADKTGIYDIGTVTIGG
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttcgattcccctcgccagtactagtaattattttggctaactgcctgatgacc
gtcgtcgggctaatcctaccccagtcagctagaacagaaacttttagtgctgattttccc
cctcccgattctgccttggatttgttgctgggacaggaaactcccttaatggaaacgaca
attccagagccggaacaagggcaggaggataaccaaagcgccccgccctctgagccaaca
ccgggcaatttgggtaatgaagacgatttatttgagcgggtattcggtcggccccgcccc
acgggggtacagcgtttggtggcgccctttttcatcaacgatttgcaacagggtcaaatt
gtagtgtttgtttccctgggagggggtagtagcctacaaatcaccgcttccactttgttg
ttgaaaatggaagaatatgcccgacctgatatacagactagattggccgatttggtggac
gacagcggtaatttaaccttggcggctctgcaaagtgtgggtctagatgccacatttaat
gaccagttgttggaactgaggattattattccccccaatctccgcaaaaccattgtctat
ggctccggtaatttacaacttcccccaggggccgccacagccctacgtcccagtaacttc
agtggttttatcaacttaattgggacccaaccctatgcctgggatggcactggtgatttg
ggccgccaagccctgaatttgggtgtagaaggggcccttaattatcagggctgggtgcta
gagggtagtgctagttttgctgagcaaagcaacaatccctggacccgctctgacattcgc
ttggtaaaggatgatccagataatgcggttcgctatgttcttggtgatctgtttagcacc
gcccgcagttatcagtcctttgtgcccatggtgggatttgcgatgtttcgcaatttctcc
ctccagccctatttgaccactaggcccacagggcagtttgaatttctgttggaaagccct
gctagggtggaaatttttgtcaatggactattgcggcaaactctccaattgccagcgggg
ccccaggatattcgtaattttggtctgaatacggggcttaataatgtgacggtgaaaatc
atcgacagtgcggggcgggtggaggaactatctttttcggctcccttagcgacggatcta
ttggcggtgggtttgaatcagtttggcttgggggtgggggttccggcctacaccaccaat
ggggtgcgtagctatgacacttcccgacccattattggcggcttttaccgccagggtatt
acgtccaccctcaccctaggaggttatctacaggcggcaggttcccagcagttgattggc
accgaaggcaccttggccacttccgtgggtaactttggttgggatgcggccctggaaaat
gatggcaacggtttagaccatgctttccgactgcggtatcaatttttggccctaggaggt
aaccaggcccaactacctaactttggtttggaagtggaatatttgggcccttattttcag
cgctttggtagttttcccatcggctttactgcggaaccattggatttttttggcaccact
actaataatgtttcttggtcttttggggctaattatagtcaaactctaatcgatggtttg
ggaattaacctcggtttgggttatcagcttggtagttttggccagcccaatgcctaccga
gcggcgatcggttttaccactaatctgggaaggggtttacaggctaatttgaccctgaac
aatcgcttagaccaatccgggcgggcagaaactcaagtattattcaactttttgcaaact
tcccagttccaatccctcacagcccgcagtaatctgagcagtcaacgggagcaggctagc
acgctcacttggacatcccgtagtcctgcccaatataacagcgtcaatacctccgttaac
ctcagcaataatcccaatcccggctattttggtactggcttagggctgacttaccggggc
tttctgggggatattaatctcaaccatgattatgatcaggctagccatcgcactaactta
aattttggtacggccttagtttatgctgatgggcgttttggctggagccgaccagtacgg
gatagttttgtgatttttagccgtaaccctaattttgcggatcaattagtattaattaat
cctggtttgtatggtcctgtggcggaagctaatgatgtcggccctggggtagtgccggat
ctaagctcctatactttgaccactatgcgggtagatgctcctaatatgccccttggctat
gacttgggcaatgcggtatttaatcttttaccgagctataaaagtggtactttaatcaca
gtgggtacggaatccaccgtatttttacgggggacgttggtagataaagcagggaacccg
attgcgcttcaagtcgggcaagttaggtctttgtctgatcccagttggtcgccgttggag
ttattcactaatcgagcgggacgatttgcgttgacaggactgggaccagggaagtatgaa
ttgcaattattcggtgatcctccccgggccattcgctttgaaattccggcggataaaact
ggtatttacgacattggaactgtgacaataggcggttaa

DBGET integrated database retrieval system