KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2246Help
Entry
SYNGTS_2246       CDS       T02098                                 

Gene name
slr0214
Definition
(GenBank) cytosine-specific methyltransferase
  KO
K00558  
DNA (cytosine-5)-methyltransferase 1 [EC:2.1.1.37]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SYNGTS_2246 (slr0214)
Enzymes [BR:syy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     SYNGTS_2246 (slr0214)
DNA replication proteins [BR:syy03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    SYNGTS_2246 (slr0214)
Chromosome [BR:syy03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    SYNGTS_2246 (slr0214)
Prokaryotic defense system [BR:syy02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    SYNGTS_2246 (slr0214)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2504947..2506221
Genome map
AA seq 424 aa AA seqDB search
MARPIAIDLFAGCGGMSLGLEAAGFDIAAAVEFDAVHCLVHHHNFPYGVTICRDIALVSA
GEILRKLNNKGYSSDIDLIAGGPPCQGFSLMGKRQLDDPRNSLVFEYVRMIRDLKPKYFL
FENVPGMRSGQHKKFLEELVREFETIGYHIEKPILVLDASLYGAPQKRKRLIILGSRKDV
KPVTYPLPLYFDVAELKQSNCSEKSVSNIAYKPPFTCGEAIDDLVDHTPYAVGEDQGIPS
ELLDYSALRKSYAIHANGAFSLCHKRQVNNLVYGHIGSQHTEKSMKRFADTVPGTVERTS
RFLRLSKTGLCNTLRAGTASDKGAYTAPRPIHYALPRCITVREAARLHTYPDWFQFHNTI
WHGFREIGNSVVPLLAKVLGEQVMAALNCSVEDLPVYELEPQDRTLLHYNLPQASRYLCA
KSHS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggccagacccattgccatcgacttgtttgcgggctgtggtggcatgtccttgggttta
gaagccgctggatttgatattgccgccgcggtggaatttgatgcagtgcattgtttggtc
catcatcataattttccctatggtgttactatctgtcgggatattgctctggtaagtgcg
ggcgaaattctaagaaagttaaataataaaggttattcaagcgatatagacctgattgct
ggaggccctccctgtcaaggcttttccctcatgggtaaaaggcagttggatgatcctcgt
aactccttggtgtttgaatatgtgcgaatgattcgggatctcaaacccaaatatttttta
tttgaaaatgttcccggtatgcgatcggggcaacataaaaaatttttagaggaattagtt
agggaatttgaaaccattggttaccacatcgaaaaaccaattttagtgctagatgcgtcc
ctctatggtgctccccaaaaacgaaaaaggttgattattctcggctccagaaaagatgtc
aagcctgtcacctatccccttccactctattttgacgttgctgaattaaaacaaagtaat
tgttctgaaaaatcagtttctaacatagcttataaaccgccatttacctgtggagaagcc
attgatgatctagttgaccatacaccctatgcagtaggagaagaccaaggtattccatca
gaattattggattattcagccctgagaaaaagttatgccatccatgcaaatggagcattt
tccctctgccataagcgccaagttaataatttagtttatggccatattggttctcaacat
actgaaaaatcaatgaaaagatttgcggatactgtccctggaacggtggaaagaaccagt
cgctttctgcggctatcaaaaactggtttatgtaataccctgagggccggcactgctagt
gataagggtgcttataccgcccctaggccaatacactacgccttacctagatgtataact
gtgagagaagcggccagactccatacctatccggattggtttcagttccacaacaccatc
tggcacggctttcgggaaattggtaactccgtcgtacctttgctggctaaggttttggga
gaacaggttatggccgcattgaattgttctgttgaggatttgccggtttatgaactggag
ccccaagaccgaacattactacattacaatttgccccaggctagtcgatatttatgtgcc
aaatcccattcctaa

DBGET integrated database retrieval system