KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2248Help
Entry
SYNGTS_2248       CDS       T02098                                 

Gene name
cobU
Definition
(GenBank) cobinamide kinase/cobinamide phosphate guanylyltransferase
  KO
K02231  
adenosylcobinamide kinase / adenosylcobinamide-phosphate guanylyltransferase [EC:2.7.1.156 2.7.7.62]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNGTS_2248 (cobU)
Enzymes [BR:syy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.156  adenosylcobinamide kinase
     SYNGTS_2248 (cobU)
   2.7.7  Nucleotidyltransferases
    2.7.7.62  adenosylcobinamide-phosphate guanylyltransferase
     SYNGTS_2248 (cobU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2507293..2507850
Genome map
AA seq 185 aa AA seqDB search
MAFPILVTGPSRSGKSEWAEHLAAQNHPSVIYIATGKENAADVDWQNRIQQHRDRRPSHW
QTLCVDQNLTDTLETLPAGSCALVDSLGGWVANTLELSPEQWQTKQRELITFATQGQNTP
ITIIFVAEETGWGVIPVYALGRIFRDRLGALTRQLGGLCGQVYLVTGGYAVDLRRWGEPL
PPPRD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcttttcctatcctcgtcaccggccccagtcgttcaggtaaaagtgaatgggccgaa
catcttgcagcgcaaaaccatccatccgttatctacattgccactggcaaggaaaatgcc
gcggacgtagactggcaaaatcgcattcaacaacatcgcgatcgccgtccgtcccattgg
caaacgttatgcgtagaccagaatttgactgacactctagaaaccctaccggcgggaagt
tgtgccttagtggactccctgggagggtgggtagccaataccctagagctatctccagag
caatggcaaactaaacaaagggaattgatcacttttgcgacacaggggcaaaatactccc
ataactattatctttgtggccgaagaaacggggtggggggtgattccagtctatgcctta
ggacgcatttttcgggaccgtttgggcgccctcactcgtcaactggggggactttgtggt
caagtttacctcgtgaccggcggttatgcagtggatttgcgccgatggggagaaccccta
ccgccaccaagggattga

DBGET integrated database retrieval system