KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2252Help
Entry
SYNGTS_2252       CDS       T02098                                 

Gene name
sll0208
Definition
(GenBank) hypothetical protein
  KO
K14331  
fatty aldehyde decarbonylase [EC:4.1.99.5]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
Enzymes [BR:syy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.5  aldehyde oxygenase (deformylating)
     SYNGTS_2252 (sll0208)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(2510330..2511025)
Genome map
AA seq 231 aa AA seqDB search
MPELAVRTEFDYSSEIYKDAYSRINAIVIEGEQEAYSNYLQMAELLPEDKEELTRLAKME
NRHKKGFQACGNNLQVNPDMPYAQEFFAGLHGNFQHAFSEGKVVTCLLIQALIIEAFAIA
AYNIYIPVADDFARKITEGVVKDEYTHLNYGEEWLKANFATAKEELEQANKENLPLVWKM
LNQVQGDAKVLGMEKEALVEDFMISYGEALSNIGFSTREIMRMSSYGLAGV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcttgctgtccgcaccgaatttgactattccagcgaaatttacaaagacgcc
tatagccgcatcaacgccattgtcattgaaggcgaacaggaagcctacagcaactacctc
cagatggcggaactcttgccggaagacaaagaagagttgacccgcttggccaaaatggaa
aaccgccataaaaaaggtttccaagcctgtggcaacaacctccaagtgaaccctgatatg
ccctatgcccaggaatttttcgccggtctccatggcaatttccagcacgcttttagcgaa
gggaaagttgttacctgtttattgatccaggctttgattatcgaagcttttgcgatcgcc
gcctataacatatatatccctgtggcggacgactttgctcggaaaatcactgagggcgta
gtcaaggacgaatacacccacctcaactacggggaagaatggctaaaggccaactttgcc
accgctaaggaagaactggagcaggccaacaaagaaaacctacccttagtgtggaaaatg
ctcaaccaagtgcagggggacgccaaggtattgggcatggaaaaagaagccctagtggaa
gattttatgatcagctacggcgaagccctcagtaacatcggcttcagcaccagggaaatt
atgcgtatgtcttcctacggtttggccggagtctag

DBGET integrated database retrieval system