KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2257Help
Entry
SYNGTS_2257       CDS       T02098                                 

Gene name
gidA
Definition
(GenBank) glucose inhibited division protein A
  KO
K04094  
methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
Enzymes [BR:syy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.74  methylenetetrahydrofolate---tRNA-(uracil54-C5)-methyltransferase (FADH2-oxidizing)
     SYNGTS_2257 (gidA)
Transfer RNA biogenesis [BR:syy03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    SYNGTS_2257 (gidA)
Chromosome [BR:syy03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    SYNGTS_2257 (gidA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2515630..2517000)
Genome map
AA seq 456 aa AA seqDB search
MTTLTPIHVIGGGLAGTEAAWQIAQAGVPVILTEMRPERLSPAHHSEDLAELVCSNSFGA
KAGDRAAGLLQTELRQLSSLIITTADRHAVPAGGALAVDRGIFSRSLTEQVASHPLVELR
RGEVTEIPREGITVLTTGPLTSPALTEDLQQFTGMEYLSFFDAASPIVVGDSINKEVAFF
ASRYDKGEAAYLNCPFNREQYFNFWQALCEAEQAPLKDFDRETAKFFEGCLPIEELAQRG
EDTMRYGPLKPVGLFDARLGDFRDPANKEKKPYAVVQLRQEDKAGQLWNMVGFQTNLRWG
EQGRVFRLIPGLENAEFVRMGVMHRNTFINSPQLLTASLHFGDRQTLFAAGQLVGTEGYA
AATAGGWLAGTNAARLALGLPLLTLPATTMMGALFNFISSASPKHFQPMPPNFGILPELP
QRIRNKQERYGQYRDRALADLTTWQTSIKSLATCRV
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaccactttaacgcccatccatgttatcggtggaggcttagcgggtacggaggccgcc
tggcaaattgcccaagcaggagttccagttattttgacggaaatgcgccccgaacgtctg
agtccagcccaccacagtgaggatttggcggagttggtctgtagcaattcctttggggcc
aaagctggcgatcgggcagcgggacttttgcaaacagaattacggcagttgagttctctc
attattaccacagcggatcgccatgcagtgccagctgggggtgctttggcggtggaccgg
ggaatttttagccggtctttgacagagcaagtggccagccatcccctggtggaattacgg
cggggggaagtaacggaaattcccagggaaggtattacggtgctgactacgggacccctc
actagcccagcgctaacggaggatttgcaacaattcaccggcatggaatacctaagcttt
ttcgatgcggccagtcccattgtggtgggggattccatcaataaagaagtagcttttttt
gcttcccgttatgacaaaggggaggcggcctatctcaactgcccctttaaccgagagcaa
tatttcaatttttggcaggcattgtgtgaggccgaacaagctcccctgaaggactttgac
cgagaaacagctaagttttttgagggatgtttacccatagaagagttggcccagcggggg
gaagacaccatgcgttacggccccctaaagcccgttggtctatttgatgcccgtttgggg
gattttcgagatcctgctaacaaggagaaaaagccctatgcagtggtgcaattgcgccag
gaagataaggcaggacaattgtggaatatggtgggttttcagaccaatttacgctgggga
gaacagggacgggttttccgcttgattcccggtttggaaaacgctgagtttgttcgcatg
ggggtaatgcaccgcaatacttttattaattccccccaacttctgaccgctagtctccat
ttcggcgatcgccagactttatttgcggcggggcagttagtgggaacggagggttatgcc
gctgccacagccgggggatggttagcgggcaccaatgcggcccggttggcgttgggttta
cctttgctcacattgccggccaccaccatgatgggagctttatttaacttcatcagttcc
gcttcccccaaacatttccagcccatgccgcccaattttggaattttaccggaattgccc
cagcggattcgtaataagcaagaacgttacggtcaatatcgggatcgagctttggctgat
ttaacaacctggcaaactagcatcaaaagtctagcaacctgtcgagtttag

DBGET integrated database retrieval system