KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2259Help
Entry
SYNGTS_2259       CDS       T02098                                 

Gene name
gidA
Definition
(GenBank) glucose inhibited division protein A
  KO
K03495  
tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
Transfer RNA biogenesis [BR:syy03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    SYNGTS_2259 (gidA)
 Prokaryotic Type
    SYNGTS_2259 (gidA)
Chromosome [BR:syy03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    SYNGTS_2259 (gidA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2520646..2522553)
Genome map
AA seq 635 aa AA seqDB search
MTLRSPVEFQDQFDVIVVGAGHAGCEAALATARLGCRTLLLTLNLDRIAWQPCNPAVGGP
AKSQLTHEVDALGGEIGKMADRTYLQKRVLNISRGPAVWALRAQTDKREYAAVMKNIVEN
QPNLSIREGMVTDLVLGDNDEIQGVQTYFGACFGAQSVVITTGTFLGGKIWIGNKSMPAG
RAGEFAAVGLTETLNELGFETGRLKTGTPARVDRRSVDYDKLEPQPPDEQVSWFSFDPEV
WVEREQMNCYLTRTTAKTHQLIKDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKESH
QIFIEPEGRDIPELYIQGFSTGLPENVQLAMLQTLPGLENCVMLRPAYAVEYDFLPATQC
YPSLMTKKVAGLFCAGQINGTTGYEEAAAQGLVAGINAARHCQGKSLIIFSREGSYLGTL
IDDLCTKDLREPYRMLTSRSEYRLILRSDNADQRLTPLGREIGLIDDRRWDLFQTKQANI
TAEKERLYSTRIKEQDAVGKEIVDYTQQKIKGSIVLAELLRRPGFHYPDLEKFQLGNEEL
KPEEKTSVEIEIKYSGYIKRQQTQIEQVSRHSQKRLPPGLNYMAIETLSMEAREKLTQFQ
PLTIGQAGRIGGVNPADINALLVYLETQLRRSVSP
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgacccttcgatcgccagtggaattccaagaccaatttgatgtcatcgtggtgggggca
ggccatgcgggttgtgaggcggccttggccacggctcggttgggctgtcgcaccctactg
ttaaccctcaacttagaccgcattgcttggcaaccctgtaaccctgcagtgggagggccg
gctaaatcccagttaacccatgaagtggatgcactggggggggaaattggcaaaatggcc
gaccgtacctatctgcaaaagcgggtgttaaatatttcccgggggccggcggtgtgggca
ttgcgggcccaaacggataagcgggaatatgcggcggtgatgaaaaatatcgttgaaaat
caacctaatctatccattcgggaagggatggtgacggatttggtgttgggggacaatgat
gagattcaaggtgtgcagacctactttggcgcttgctttggagcccagtcggtggtgatt
acgacagggactttcctggggggcaaaatttggattggtaataagtccatgccagcgggg
cgggccggcgaatttgcggcagtaggcctaacggaaactttgaatgaactgggctttgaa
actggcaggttaaaaacgggaactccggccagggttgatcggcgatcggtagattatgac
aaattagagccccaacccccagatgaacaggtaagttggtttagctttgacccggaagtg
tgggtagagcgggagcaaatgaattgttatttgaccagaacaacagctaagacccaccaa
ttaattaaagataatctccatttatctcccatttatggcggttttattgactctaagggg
ccccgttattgtccttccatcgaagataaaattgttcgtttcgctgacaaagaaagtcac
caaatttttatcgagccggaaggtcgagacattcctgaattgtatattcaaggtttttcc
acggggctaccggaaaatgtgcaattggccatgctacaaactctaccggggttggaaaat
tgtgtcatgttgcgccccgcttacgcagtggaatacgactttttaccggctacccagtgt
tatcccagtttgatgaccaaaaaagtggcaggactattttgtgctgggcaaattaacggc
accactggctatgaagaagcggcggcccagggtctggtggcggggatcaatgcggcccgt
cattgtcaaggaaaatcattgatcatcttctcccgggagggaagttatctgggtacatta
attgatgatttatgcaccaaagatttgcgggaaccctaccggatgctcaccagccgttcc
gagtaccgcttaattttacgttccgacaatgccgatcaaaggttaacccctctgggaagg
gaaattggcttaattgacgatcgccgttgggacctattccaaaccaaacaagctaacatc
accgccgaaaaagaaagactgtacagtacccgcatcaaagagcaagatgcagtgggtaaa
gaaattgttgattatacccaacagaaaattaaaggctccattgtgctggcggagttacta
cgacgacctggatttcattatccagatttagaaaaatttcagttgggtaacgaggaatta
aaaccggaggaaaaaaccagcgtggaaatcgaaatcaaatattccggctacattaagcgg
caacaaacccaaattgaacaggtgagccgccatagccaaaaacgtttgccccccggctta
aattacatggccattgaaaccctatccatggaagcaagggaaaaactaacccagttccaa
cccctcaccattggtcaagccggtcgcattgggggcgttaaccccgccgatatcaatgcc
ctcctggtttatctagaaactcaactcaggcgatcggtttccccctga

DBGET integrated database retrieval system