KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2260Help
Entry
SYNGTS_2260       CDS       T02098                                 

Gene name
slr0224
Definition
(GenBank) hypothetical protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2522683..2523378
Genome map
AA seq 231 aa AA seqDB search
MDHLFWIYILVFFAIILFRYFLIAGGTYAFFYSPWGQSLLKNHLPINIPSSQSIRKDIKL
SIISAIIFALAGAFILSSYGGKMNRLYVDPYQHGLWYLGISYVLILFLQDTYFYFTHRLF
HHPRLFSLFHKGHHLSRYPTPLTSFAFDLPEAIVQSFFLIIVVSLIPLHFFTLLAILMTM
TIWSVINHLGIDRLPLAFPHHWLGKYFIGTAHHSLHHLKYNANYGLYSSFK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggatcatttattttggatttatatacttgtattttttgctattattttgtttagatat
tttctaattgcggggggaacctatgcttttttttactccccttggggtcaatcgttactt
aagaaccatttacccattaatattccctcttcgcaatcaattcgcaaagatataaaactt
tccataatttcagcaattatttttgccctggcaggggcatttattttgtcgagctatggc
ggaaaaatgaatcgtttatacgtcgatccataccaacacggactttggtatctgggaata
agttacgttttaattttgttcttacaagatacctatttttatttcacccatcgccttttc
catcatccgagattgttttctttgttccataaaggacatcatctttcccgttatcctacc
cccctcacttcctttgcctttgatctgccagaggcgatcgtgcaatcattttttttaatt
attgttgtttcccttattcctctccatttttttactttattagcgatattaatgaccatg
acaatttggtcggtgattaatcatttgggtatcgatcgcctacctttagcatttcctcat
cattggttagggaaatactttattggcacggcccatcattccctacatcacctcaaatac
aatgccaactatgggttgtatagtagtttcaaataa

DBGET integrated database retrieval system