KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2261Help
Entry
SYNGTS_2261       CDS       T02098                                 

Gene name
sll0201
Definition
(GenBank) transposase
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2523389..2523883)
Genome map
AA seq 164 aa AA seqDB search
MLRELIKLYGSQAIVYIDESGFEAIQACIYAWSKKGKKVYGDRQGKRGVRENLVAGRRKG
KKDLIAPMVFTGSLNAEGFEGWLKLYLLPSLDIPSILIMDNAPIHRKTAIKELAKEAGHE
VLFLPKYSPDLNDIEHDFSALKRARMYAPIDTSLDEIIRSYCGV
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgttaagagaactaattaagctctatggtagtcaagctatagtttacatagatgaatct
ggattcgaagcaatccaggcttgtatttatgcctggtcaaaaaaaggaaaaaaagtttat
ggagatagacaaggaaaaaggggagtcagagaaaatctagtagcagggagaagaaaagga
aaaaaagatttgattgcgccgatggtttttaccgggagtttgaatgcagaaggctttgaa
ggatggttaaaattatatttgctaccctccctcgacattccatcaatattaataatggat
aatgctcctattcatcgtaaaactgccattaaagaattggctaaagaagcaggtcatgaa
gttctttttttgccgaaatattctcctgatttaaatgatattgagcatgactttagtgcc
ttgaaacgagctagaatgtacgctcctattgacacgtctcttgatgaaattatccgttct
tactgtggcgtttag

DBGET integrated database retrieval system