KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2267Help
Entry
SYNGTS_2267       CDS       T02098                                 

Gene name
sll0195
Definition
(GenBank) ATP-dependent proteinase BsgA
  KO
K01338  
ATP-dependent Lon protease [EC:3.4.21.53]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
Enzymes [BR:syy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.53  endopeptidase La
     SYNGTS_2267 (sll0195)
Peptidases [BR:syy01002]
 Serine Peptidases
  Family S16: lon protease family
   SYNGTS_2267 (sll0195)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2529784..2530428)
Genome map
AA seq 214 aa AA seqDB search
MASSVAIRELPLFPLPEVVLFPGRPLPLHIFEYRYRMMMNTILEDDRRFGVLMIDPSTGE
ISDVGCCAEVLRYQRLPDDRMKVLTLGQQRFRVLEYVREKPYRVGLVEWIDDKYTGQDLH
GLAKEVDRLLHDVVSLSAKLTDQNLELPDDLPVLPVELSYWVAGNLYGVASEQQSLLELQ
DTAERLQREAEILMSTRNHLAARTALKDVLGTEE
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctccgttgcaattagggaacttcctctttttccactgcctgaagttgtgctt
ttccctgggcgacccctgcccttgcacattttcgagtaccgctatcggatgatgatgaac
accatcttggaagacgatcgccgttttggggtgttgatgattgatcccagcacaggggaa
atttccgacgtgggttgctgtgcagaagtattgcgctaccaaaggttacccgatgaccgg
atgaaggttttaactctggggcaacaacggtttcgggtgctggaatatgtgcgggaaaag
ccctaccgagtcggtctagtggaatggattgacgacaaatacacggggcaggatctccat
ggcttggccaaggaagttgatcgcctgttgcatgacgtagttagcctgtcggccaagttg
acggatcagaacttggaattacccgatgatttgcccgtgttgccggtggaattgtcctat
tgggtcgcaggcaatctttatggcgttgccagtgaacaacaaagtttgttggaattgcag
gacactgctgaaagattacaaagggaagcggaaattctcatgtccacccgcaaccacctc
gccgcccgcaccgccttgaaagatgttttaggcacagaagaatag

DBGET integrated database retrieval system