KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2268Help
Entry
SYNGTS_2268       CDS       T02098                                 

Gene name
ycf43
Definition
(GenBank) hypothetical protein
  KO
K03118  
sec-independent protein translocase protein TatC
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Protein export
Bacterial secretion system
Module
Twin-arginine translocation (Tat) system
Brite
KEGG Orthology (KO) [BR:syy00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    SYNGTS_2268 (ycf43)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    SYNGTS_2268 (ycf43)
Secretion system [BR:syy02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein [MD:M00336]
   SYNGTS_2268 (ycf43)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2530482..2531246)
Genome map
AA seq 254 aa AA seqDB search
MSTQLDNITSAETAPDYLDEVPDDVEMSLFDHLDELRTRIFLSLGAVLVGVVACFIFVKP
LVQWLQVPAGTVKFLQLSPGEFFFVSVKVAGYSGILVMSPFILYQIIQFVLPGLTRRERR
LLGPVVLGSSVLFFAGLGFAYYALIPAALKFFVSYGADVVEQLWSIDKYFEFVLLLMFST
GLAFQIPIIQVVLGFLGIVSSEQMLKGWRFVILGAMVLGAILTPSTDPLTQSLLAGAVLG
LYFGGIGCVRLLGK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacccagcttgataacatcacttccgcggaaactgcccccgattatttggacgaa
gtgcccgatgacgtggaaatgtctttgtttgatcacctcgacgaactcagaactcgtatt
tttctgtctttgggggcggtcttggtcggggtagtggcctgctttattttcgttaaaccc
ttggtgcaatggcttcaagtcccggcaggcacagttaaatttctgcagctctccccaggg
gaattctttttcgtttccgtcaaagtagcaggctacagcggcattctggtgatgagcccc
tttatcctctaccaaattattcaattcgttctacccggtctaacccgtcgggaacgccga
ttactgggaccggtggtgctaggctccagtgtacttttttttgctggactgggctttgct
tactatgctctcatccccgccgcactcaagttttttgtcagctacggagcggatgtggtg
gagcaactctggtcgattgataaatattttgagtttgtgctgttgttgatgtttagcacc
gggctagcttttcaaattccgattattcaagtggttctcggctttttgggcatcgtttcc
tccgaacaaatgctcaagggctggcgctttgtcattttgggggcgatggtgctgggggca
attctcaccccttccacggaccccctgacccagtcccttctagctggggcagtgctgggg
ctttactttggcgggatcggttgcgtgcgcttactgggtaaatag

DBGET integrated database retrieval system