KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2269Help
Entry
SYNGTS_2269       CDS       T02098                                 

Gene name
mmsB
Definition
(GenBank) 3-hydroxyisobutyrate dehydrogenase
  KO
K00020  
3-hydroxyisobutyrate dehydrogenase [EC:1.1.1.31]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SYNGTS_2269 (mmsB)
Enzymes [BR:syy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.31  3-hydroxyisobutyrate dehydrogenase
     SYNGTS_2269 (mmsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2531639..2532511
Genome map
AA seq 290 aa AA seqDB search
MNVSKIAVFGLGVMGSPMAQNLVKNGYQTVGYNRTLERPSVQEAAKAGVKVVTSIAVAAA
NADIILTCVGDEKDVQQLILGSGGIAEYAKPQALIIDCSTIGKTAAYELATNLKLQGLRF
LDAPVTGGDVGAINGTLTIMVGGDISDFEEALPVLKSIGEKIVHCGPSGSGQAVKLCNQV
LCGIHAIAAAEAIQLSEQLGIAPELVIDTCGSGAAGSWALTNLAPKMSEADFAPGFMVKH
LLKDLRLVREAAENGPLPGVTLAESLFTSVQLLGGEDQGSQAIIRAYREA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtttccaaaattgcagttttcggtttaggagttatgggcagtcctatggctcaa
aacctagttaaaaatggttatcaaacagttggttataaccgcaccctagagcgtccttct
gtccaggaagcagcaaaggcaggggttaaagttgttactagcattgcggtggcggcggca
aatgcagatattattctcacctgtgttggagatgaaaaagatgttcaacagcttatttta
ggttcgggagggattgctgaatacgctaaaccccaagccttaataattgattgcagtacc
attggtaaaactgcggcttatgaactagctacaaatttaaaactccagggtttacgcttt
ttggatgcgccggtaacaggaggtgacgttggcgcaatcaacggtacgttaacgattatg
gtggggggtgatatttcggattttgaagaagctttacccgtcctcaaatccataggagaa
aaaatagtccactgtggtcccagtggcagtggtcaagctgttaagctttgtaatcaggta
ctttgtggcatccatgcgatcgccgctgcggaagctatacaactttctgagcagttgggg
attgccccagagttagtaattgatacttgtggcagtggggcggcgggttcctgggccttg
actaatttagcaccgaaaatgtcggaggctgattttgccccaggctttatggtcaaacat
cttcttaaggatctgcgcctcgtccgggaagccgctgaaaatggcccattaccaggggtt
acgttggcagaaagcttgtttacatcggttcaattattggggggagaagaccagggttcc
caagccattatccgtgcctatcgcgaagcttag

DBGET integrated database retrieval system