KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2270Help
Entry
SYNGTS_2270       CDS       T02098                                 

Gene name
slr0230
Definition
(GenBank) transposase
  KO
K07494  
putative transposase
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2532922..2533770
Genome map
AA seq 282 aa AA seqDB search
MAYSLDLRQRVVAYIEAGGKITEASKIYKIGKASIYRWLNRVDLSPIKVERRHRKLDWEA
LKKDVEENPDARLIDRAKKFGVRPSAVYYALKKMKINRKKKELRYRERNREERVKYYRML
RELIKLYGSQAIVYIDESGFEAIQACIYAWSKKGKKVYGDRQGKRGVRENLVAGRRKGKK
DLIAPMVFTGSLNAEGFEGWLKLYLLPSLDIPSILIMDNAPIHRKTAIKELAKEAGHEVL
FLPKYSPDLNDIEHDFSALKRARMYAPIDTSLDEIIRSYCGV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcttacagtttagatttaaggcaaagggtagtagcttatatagaagctggaggaaaa
ataactgaggcttccaagatatataaaataggaaaagcctcgatatacagatggttaaat
agagtagatttaagcccaataaaagtagagcgtcgccataggaaattagactgggaagct
ctaaaaaaagacgtagaagaaaatcccgatgcaagattgatagacagagccaagaaattt
ggagtgaggccgagtgccgtatattacgcattaaagaaaatgaaaataaacagaaaaaaa
aaagaactacgttatcgagaaagaaaccgggaggaacgagttaagtactatagaatgtta
agagaactaattaagctctatggtagtcaagctatagtttacatagatgaatctggattc
gaagcaatccaggcttgtatttatgcctggtcaaaaaaaggaaaaaaagtttatggagat
agacaaggaaaaaggggagtcagagaaaatctagtagcagggagaagaaaaggaaaaaaa
gatttgattgcgccgatggtttttaccgggagtttgaatgcagaaggctttgaaggatgg
ttaaaattatatttgctaccctccctcgacattccatcaatattaataatggataatgct
cctattcatcgtaaaactgccattaaagaattggctaaagaagcaggtcatgaagttctt
tttttgccgaaatattctcctgatttaaatgatattgagcatgactttagtgccttgaaa
cgagctagaatgtacgctcctattgacacgtctcttgatgaaattatccgttcttactgt
ggcgtttag

DBGET integrated database retrieval system