KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2272Help
Entry
SYNGTS_2272       CDS       T02098                                 

Gene name
sll0192
Definition
(GenBank) hypothetical protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2534303..2535574)
Genome map
AA seq 423 aa AA seqDB search
MLPKILLLSNGHGEDAIAVSIGQAWSELAGMEPGEILVGLPLVGEGNSYRRLNILLIGPV
KTMPSGGFNNMDARELWRDVQGGLWGLTKAQLGGLQKWTAQGGKVLAVGDIVPLALAWLG
RGDYAFVGTAKSEYYLRSPAGAWLPSTQAWEKWLGCAYYPWERWLMTRKNCVAVFPRDRL
THESLLNQGVASYAVGNPMMDGLNPQDYKPQTLQPGQSLTITLLPGSRSPEMERNWALIV
ESLTSVLAHFADASITFLAAIAPSLPLPTLMAELETQGWQPLEDNAVELLTNKVSCLIKG
PVFQKDHARLVFSQQQFADCLHHAQAAIAMAGTATEQFVGLGKPVISFPGQGPQYNPYFA
RRQTWLLGESLILLNSPDQTGEALQQVLHDVERLEAIACNGRERLGQAGAARRIAEILRE
QWC
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgaagattctactgctcagcaatgggcacggagaggatgcgatcgccgtcagt
attggccaggcttggagtgagttggcgggaatggagcctggggaaatattagtgggattg
cccctagtgggggaaggcaacagttatcgacgtttaaatattctcttgattggcccggtg
aaaaccatgccctccggcggctttaacaacatggatgccagggaattatggcgggatgtt
cagggaggcttatggggattgaccaaagcccagttaggcggtttgcaaaaatggacggcc
cagggggggaaagttctagcggtgggggacatagtgcccttggccctcgcttggttgggc
cgaggtgattacgcctttgtgggcacagccaagtcggaatattatctgcgctcccccgct
ggggcatggttacctagtacccaagcttgggaaaaatggcttggttgcgcttactatcct
tgggaacggtggttaatgacgaggaaaaattgcgtagcagtctttccccgcgatcgcctc
acccatgaaagtttgttaaaccaaggtgtggccagttatgccgtgggcaatccaatgatg
gacggtttaaacccgcaggattacaagccccaaacgttacagccaggacaaagtttaacc
attacccttttacccggttcccgatcaccggaaatggaacgcaattgggccttgattgtg
gaaagtttaaccagtgtgttagcccattttgccgatgcttccataactttcctggcggcg
atcgccccttccttgcccttaccaacgttgatggctgaactggaaacccaaggttggcaa
ccactggaagataatgccgtggaacttttgaccaacaaggtttcttgcttgattaaaggg
cccgttttccaaaaagatcatgcccggctggtttttagccaacagcagtttgccgattgt
ttgcaccatgcccaagcggcgatcgccatggccggtaccgccacagaacaatttgtcggg
ttggggaaaccagtgattagttttcccggacaaggcccccaatacaatccctattttgcg
cgccgtcaaacctggcttttgggagaatccttaattttgttgaatagtcctgaccaaact
ggggaagctttacaacaagtacttcatgatgttgagcgactagaggcgatcgcctgtaat
ggccgggaaaggctgggacaagctggagcggcccgccgcattgcagagattctcagggaa
caatggtgttag

DBGET integrated database retrieval system