KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2277Help
Entry
SYNGTS_2277       CDS       T02098                                 

Gene name
sll0415
Definition
(GenBank) ABC transporter
  KO
K01990  
ABC-2 type transport system ATP-binding protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Module
ABC-2 type transport system
Brite
Transporters [BR:syy02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    SYNGTS_2277 (sll0415)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2539637..2540701)
Genome map
AA seq 354 aa AA seqDB search
MRFRCYLIFSIFSDSLLGAGFFQGGKRAMVVSTPIAAEEKPPIQANVVETWEISKIYRTG
FWMNQKVESLKPLSIAVQQGETFGLLGPNGAGKTTLLKILLGVIRASGGRGTLLGKPIGD
RQTKQRVGYLPENAYFYDFLTAWEFLDYIGSLFQIGKQERQRRILAMCDLVGLAQKTAKK
KQLRQYSKGMLQRVGMAQALINDPEVVFLDEPMSGLDPLGRYQVREIILSLKEQGKTIFF
NSHILADVEQICDRIAILARGELLCSGSLAEVLGNDEGYEVVLKGGEEEALGKYLANLSQ
EQDVWHGHYQGDVQALVDALPSLNARLISMNLARPSLEDYFIRQLRERGITTSQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttcgatgttacttaatatttagtatatttagtgactcgctcttgggagcagga
ttttttcagggaggaaaaagagcaatggttgtgtcaactccgatcgccgctgaggaaaag
ccaccgattcaggccaatgtggtggaaacttgggaaattagcaaaatctaccgcaccggc
ttttggatgaatcagaaggtggagtcccttaaacctttgtccattgccgtacagcaaggg
gaaacctttggtttactgggtcctaatggagcaggtaaaactaccctgttaaaaattctt
ttgggggtaattcgtgccagcggtggccggggtactctactaggcaaacccatcggcgat
cgccagactaaacaacgggtgggctacctaccggaaaatgcctacttttatgacttttta
accgcttgggaatttttggattacatcggcagtctgtttcaaattgggaaacaggaacga
caacggcgcattctggccatgtgtgacctggtggggttagcccaaaaaaccgccaaaaag
aagcaattgcgacaatattccaaaggtatgttgcaacgggtgggcatggcccaggcattg
attaacgatcctgaagtcgttttcctcgatgaacccatgtccggtttggaccccctgggg
cgctaccaagtgcgggaaattattctttccctcaaggaacagggcaaaaccatctttttc
aactcccacattttggcggacgtggaacaaatttgtgaccgcattgccattttggcgcgg
ggggaattgctgtgcagtggttctttggcggaagtgttaggtaatgacgaaggctatgaa
gtggtgctcaagggaggagaagaagaggcgttgggtaaatatctagccaatttaagtcag
gaacaggatgtttggcacggccattaccaaggggatgtccaagctctagtggatgcgtta
cccagtcttaatgcccgtttgatcagcatgaacctggcccgcccttccctggaagattat
ttcatccgccaactgcgagaacggggtatcaccaccagccagtga

DBGET integrated database retrieval system