KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2279Help
Entry
SYNGTS_2279       CDS       T02098                                 

Gene name
slr0431
Definition
(GenBank) hypothetical protein
  KO
K09807  
uncharacterized protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2541751..2542503
Genome map
AA seq 250 aa AA seqDB search
MRPKFFSRRPTMGISKLSKFSASVLLSGAILTTLPPSPLWANEMQQLLTVTGQASESVPT
TLTEAQLTVEVQADTADQVQTAIAERSNRLVAYLRSQRVDKLQTQGLQLQPNYVYSNNER
RLEGYIGSNTVSFQYPSDQVGKILDEAVRAGASRIDGIRFIATPETLKAAEQKALVAATA
DAQAQARVVLSSLNLTPQNIVRIVINPSPDQPMPLFRGALAASPMAESAPTPIISGDQTV
QATVTLEIAY
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaccaaaatttttttctaggaggccaactatgggcatatcaaaactttctaaattt
tctgcatccgtgctcttgtccggtgcgatactcaccaccttgcccccctctcccctctgg
gctaacgaaatgcaacaattgctcactgtcaccggccaagcttcggagtctgtccccacc
accctaacggaggctcagctaacagtggaagtccaagccgataccgctgaccaggtgcaa
acggcgatcgccgaacggagtaaccgtctggtggcctatctacgcagtcaaagggtggat
aaattacaaacccaaggactccaactccaacccaattatgtttacagcaataacgaaaga
agactggaaggttacatcggcagtaacaccgtcagttttcagtacccaagcgaccaagtg
ggaaaaatccttgatgaagctgtgcgggccggggccagtcgcatcgatggtatccgcttt
attgccactcctgaaaccctcaaagcggctgagcaaaaggccctagtagccgccaccgcc
gatgcccaagcccaagctcgggtggtgttgtccagtttgaatctaacgcctcaaaacatt
gtccgtattgtcattaaccctagcccggaccaacccatgcccctttttcggggcgccctg
gccgcctcccccatggcagagtctgctcccacccccattattagcggtgaccaaacagtg
caggccacagtaactttggaaattgcctattaa

DBGET integrated database retrieval system