KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2284Help
Entry
SYNGTS_2284       CDS       T02098                                 

Gene name
sll0410
Definition
(GenBank) hypothetical protein
  KO
K07107  
acyl-CoA thioester hydrolase [EC:3.1.2.-]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
Enzymes [BR:syy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SYNGTS_2284 (sll0410)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2545344..2545844)
Genome map
AA seq 166 aa AA seqDB search
MSDSPKPQLPPSPQGDHCLVHQQELEAVTEKWFEIMVRVQPHHTDYGGVVWHGTYLTWLE
TARVECLRSIGVDFADLVKLGCDLPVVSLALRYHRAIRLGQTAVIKVQMQEIQKVRLEWQ
NQIVCLETGEPCVTGKITLVAIDPAKGKIMRRLPPVVQEHLLKLRQ
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgattcccccaagccccaattacccccaagcccccagggagaccattgtctagtt
caccaacaggaactggaagctgtgaccgaaaagtggtttgagattatggtccgggtacaa
ccccaccacactgattacggcggcgttgtttggcatggcacctacctaacctggctggaa
accgcccgagtggaatgtttgcggtccattggagtggattttgccgacttggtcaagctg
ggttgtgatttacctgtggtgagcctggccctacggtaccaccgagccatccgcttggga
caaacagcagtgattaaagtgcaaatgcaagaaattcagaaagtgcggctggaatggcaa
aatcaaattgtttgtctggaaaccggggaaccctgtgtaactggcaaaattaccctagtg
gcgatcgaccctgccaagggcaaaattatgcgccgtttaccaccggtggtacaggaacat
ttactaaagctgagacagtga

DBGET integrated database retrieval system