KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2285Help
Entry
SYNGTS_2285       CDS       T02098                                 

Gene name
sll0409
Definition
(GenBank) hypothetical protein
  KO
K02549  
O-succinylbenzoate synthase [EC:4.2.1.113]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SYNGTS_2285 (sll0409)
Enzymes [BR:syy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     SYNGTS_2285 (sll0409)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2545884..2546846)
Genome map
AA seq 320 aa AA seqDB search
MDKPYHVKFYSYNFPLPKPVVTAHGHWQRRRGLIVELTDQRGNRGRGEIAPLPWFGTEDL
ASATDFCRSLKGRITPAQIEKIGDRLPCCGFAFGSAEWELESGSVIENSPNSLSYCQLLP
TGEAALDYLASNPQLGASTFKWKIGVGDFAVERDLYGQLWRRLPEGCQIRLDANGGLSVD
IAQQWLTLLDRQRENSGPKIQYLEQPLPPGEIDEMFRLQEDFATSIALDEAVCSLAQLAQ
LYDKGWSGLYILKAAIMGNPRVLNHWLKTHPIPAIFSSVFETAIARGQVLALAQKWNLPD
HAVGFAPLREPITEATPDSV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggataaaccctatcacgttaaattttattcctacaatttccccctgcctaagccagtg
gtaacagcccatggccattggcaacggcgacggggcttgattgtggagttaaccgaccaa
aggggtaacaggggccgaggagaaattgctcccctaccctggtttggcacggaagattta
gccagcgccacggatttttgccgcagtttaaaaggtcggattacccccgcgcaaattgag
aaaattggcgatcgcctaccctgttgtgggtttgcctttggctcagcggagtgggagtta
gagagcggcagtgtgattgaaaattcccccaactctctcagttactgtcaacttttgcct
acaggggaggccgccctggattatctcgcctccaatccccagttgggagctagcacgttt
aaatggaaaattggcgtcggggattttgctgtagaaagggatttgtatgggcagttatgg
cgacggttaccggaaggctgtcaaattcgcctcgatgccaacggcggtttgagtgtggac
atcgcccaacaatggttaactctcctcgatcgccaaagggaaaattctgggcccaaaatt
caatacctggagcaacccctgcctcctggggaaattgacgagatgtttcgactgcaagaa
gattttgctacctccatcgccctagacgaagcggtatgcagcttagctcaactcgcccaa
ctctacgataaaggttggtccgggctttacatcctcaaagccgccatcatggggaatcct
agggtactgaaccattggttaaaaacccatcccatccccgccattttttcctccgtgttt
gaaacggcgatcgccaggggtcaagtgttggccctggcccaaaagtggaacttaccagac
catgccgttggctttgctcccctaagggaacccataacagaggccaccccggactcggta
tga

DBGET integrated database retrieval system