KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2288Help
Entry
SYNGTS_2288       CDS       T02098                                 

Gene name
accB
Definition
(GenBank) biotin carboxyl carrier protein of acetyl-CoA carboxylase
  KO
K02160  
acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYNGTS_2288 (accB)
   01212 Fatty acid metabolism
    SYNGTS_2288 (accB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SYNGTS_2288 (accB)
   00640 Propanoate metabolism
    SYNGTS_2288 (accB)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SYNGTS_2288 (accB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2548876..2549340
Genome map
AA seq 154 aa AA seqDB search
MAINFTELRELLGVISQSNITEFSLKSGDFEVSVRKDGMAGGISVVPQAIAPQPAPVVSA
SVPSPEVAAPSPADQKWTAIVSPMVGTFYRAPAPDEPPFVEVGDAVSKGQGVCIIEAMKL
MNEIEAEVAGQVMEIVVENGEPVEYGQTLMWIKP
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtggctattaactttacggaactgcgggaattgttgggggtaatttcccaaagtaatatc
acggagttcagtctaaaaagcggcgattttgaggtgtcagtccgtaaggatggtatggcc
ggcggcatctccgttgtccctcaggcgatcgccccccagcctgccccggtggtttctgcc
tcagttccctcccccgaagttgcggccccatccccagcggatcaaaagtggacggcgatc
gtttcccccatggtgggtactttttaccgagccccagccccggatgagcctccctttgtg
gaagtgggagatgcagtcagcaaaggccagggagtgtgcatcattgaagcaatgaagtta
atgaatgaaattgaagcggaagtggcggggcaagtgatggagattgtggtggaaaatggg
gagccggtggaatacggtcaaaccctaatgtggattaaaccctag

DBGET integrated database retrieval system