KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2289Help
Entry
SYNGTS_2289       CDS       T02098                                 

Gene name
ccmK
Definition
(GenBank) carbon dioxide concentrating mechanism protein CcmK
  KO
K08700  
carbon dioxide concentrating mechanism protein CcmO
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2549570..2550463
Genome map
AA seq 297 aa AA seqDB search
MPTSPTMTSVPIARSPRPSYQQINQHQPSDSALGLVSTRSFPAIVGTADMMLKSSQVTLV
GYEKIGSGYCTAVVRGKVADVRLAVEEGARTAEQFGQLVSKLVIPRPMPNLQAVFPIGSH
LVELAQQQRGYSRLSNRSIGLLETRGFPAMVGAADAMLKSADVQLASYEIIGDGLCTAIV
RGTVANVAMAIEVGMQEAERIGELHAVMIIPRLLEDLEHTLPVATYWLDENEPLPMLLPN
QVREKQRQLVALPELEKAVVPQRQAKPLPLQEKTEAPLVLEKEAEKPIVEVLGPEID
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgccgacttccccaacaatgactagcgtccccattgcccgttccccgcgccccagttat
cagcaaataaatcaacatcaacccagtgatagtgccctggggttagtctccaccagaagc
tttccggcgatcgtggggacagcagacatgatgctgaaatcttcccaagtgaccctggtg
ggctacgaaaaaattggcagtggctactgtaccgcagtggtacggggcaaggtggccgat
gtgcgcctagcagtggaagagggggccagaacagcagaacagtttggccagttagtgtcg
aaattggttattccccggcccatgcccaacctccaggcggtattccccatcggtagtcat
ctggtagaacttgctcaacagcaacggggttacagtcgtttgagcaatcgatccattggc
ctattggaaaccagaggttttccggctatggtgggggccgccgatgccatgctcaaatcc
gccgatgtgcagctagcttcctacgaaattattggagatggcctttgcaccgccattgtc
cggggaacggtggccaatgtggccatggcgatcgaggtggggatgcaggaagcagaacgc
attggggaactccacgcagtaatgatcattccccgattgttagaggatttggaacatacc
ctgccagtagccacctattggttggacgaaaatgaacctctaccgatgttactgcccaat
caagtccgggaaaaacaacggcaattggtggccttaccggaattagaaaaggctgtagta
ccccaacgtcaggcaaaaccgttgcctttgcaagagaaaacagaagctcccttagttcta
gaaaaagaggcggaaaagcccatagtggaagtgctaggtccagaaattgattag

DBGET integrated database retrieval system