KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2295Help
Entry
SYNGTS_2295       CDS       T02098                                 

Gene name
slr0439
Definition
(GenBank) hypothetical protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2555631..2557136
Genome map
AA seq 501 aa AA seqDB search
MSYLNLDTFMTLVLPKLLRMTLVSFVIASVVGSVVGWIATLIWRGKNLSDLSDSPNPRGW
LIKPAIFGSFIGMVLIGLLPIEANPASLVGGPYSGLWFLMMFVFLAPLGSIAGAVIGATL
GTKQFSQIKREKLIGIVLLLTYFFATVVLYVGLAPPALVMEKPTGNDPFPVVGELKGYES
GPKDLALSDNGQQLAVVTVRYGEDKVEIWDLPRKKVLYSFKTKPNSSVTLKDILSSLEFS
KDGQQLITAAVQQVQVRDLTNGAVQMRLEGGELAYPIADNKLVTLASVDAWANEPEPHNI
KVWDLDTGKLLQTINADLAPTERFSVPIAISPDGRLVAFPPGLYSDRIEIWDIGNQKQVT
ALTSNQPAGVLSLAFSPDGEQLAVALGQGAPLSVWDWRSPKQVKTIAKADRAEVLYWTEQ
GIFVGSDGAFQVWDPQTGEARQKLDLQPTEERAKSDLRFPLGPSALSADRTTLAVYIPQQ
GIRVWRVEVAPKKRTGEKALN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgagttatctgaacctagacacattcatgacattggttttacctaaactcttacgcatg
accctggttagttttgtaattgccagtgttgtggggtcagtggtgggctggatcgctact
ctaatttggcggggaaaaaatttatcggatttatcagattctcccaaccccaggggatgg
ttaatcaaaccggccatatttggctccttcattggtatggtactcatcggcctattaccc
atcgaagcgaatccagcttcccttgttggtggcccctattcggggctgtggtttttgatg
atgtttgtgtttttagctcccctcggttccattgctggggccgttatcggtgcaaccctg
ggaactaagcagttttctcaaattaagcgggaaaagttaattggcattgttttactgtta
acctacttttttgccactgttgtcctttatgttggcctggctcccccggcattggtcatg
gaaaaaccgaccggaaatgatccttttccggtggtaggtgaactgaagggttatgaaagt
gggcctaaagaccttgccctcagtgataacggtcaacaactggcggtggtaacggtgcga
tatggggaagacaaggttgaaatttgggatttgccccgcaaaaaggttttatattccttt
aagaccaagcccaatagctcagtaaccctaaaagatattctttcatctctagaatttagc
aaggatggccaacagttaatcactgcggctgttcagcaagtgcaggtgcgggatttaacc
aacggtgcagtgcaaatgcgcttagaaggaggagaattagcctatccgatcgccgataat
aagctggtaacgttggcgtcggtggatgcctgggcaaatgagccagaaccccataacatc
aaggtttgggacttagacaccgggaaattattgcaaaccattaatgccgatctggccccc
acggaacgattcagtgtgcccattgcaattagtcctgatggtcgtttagtggcttttccc
cccggactttatagcgatcgcattgaaatttgggatataggcaaccagaaacaagttaca
gccctaaccagtaaccagccagcgggggttttgtccctggcattttccccggatggagaa
caattggccgttgctctgggtcaaggtgcccccctttccgtttgggattggcgatcgcca
aagcaagtcaagaccattgccaaggctgaccgggctgaagttttgtattggacggaacag
ggaatttttgtgggtagcgatggtgctttccaggtgtgggatccacaaacgggagaggct
cggcaaaagctggatttacaaccaacagaggaaagggcaaagagtgatctccgatttccc
cttggcccctcggctctgagcgctgaccgtacaactctggcggtttatattcctcaacaa
ggtatccgggtctggcgggttgaggtggccccaaaaaagcggacaggggagaaagctcta
aactaa

DBGET integrated database retrieval system