KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2297Help
Entry
SYNGTS_2297       CDS       T02098                                 

Gene name
aspC
Definition
(GenBank) aspartate aminotransferase
  KO
K00812  
aspartate aminotransferase [EC:2.6.1.1]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Cysteine and methionine metabolism
Arginine and proline metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SYNGTS_2297 (aspC)
   00270 Cysteine and methionine metabolism
    SYNGTS_2297 (aspC)
   00220 Arginine biosynthesis
    SYNGTS_2297 (aspC)
   00330 Arginine and proline metabolism
    SYNGTS_2297 (aspC)
   00350 Tyrosine metabolism
    SYNGTS_2297 (aspC)
   00360 Phenylalanine metabolism
    SYNGTS_2297 (aspC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYNGTS_2297 (aspC)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SYNGTS_2297 (aspC)
Enzymes [BR:syy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     SYNGTS_2297 (aspC)
Amino acid related enzymes [BR:syy01007]
 Aminotransferase (transaminase)
  Class I
   SYNGTS_2297 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2557637..2558806)
Genome map
AA seq 389 aa AA seqDB search
MRLTQRVSQVVPSITLEITAKAKAMRTEGIDVLSFTAGEPDFTTPPHIVEAAKLALDEGK
TRYGPAAGEPALRQAIAKKLREKNNLPYEAANILVTNGGKHSLFNLMLAMIEQGDEVIIP
APYWLSYPEMVRLAEGTPVIVNTTAATDYKITPEQLRQAITSKSKLFVLNSPSNPTGAVY
TPAEIRALAAVILEYEDLYVVSDEIYERILYDGTEHLSIGAVNDEIFQRTIISNGFAKSY
SMTGWRVGYLAGELPLIQACSTIQGHSTSNVCTFAQYGAIAALENPQTCVETMVKAFTER
RQVIVEGINQIAGLSCPNPKGAFYVFVDIAKTGLNSLEFSARLLESHQVAVIPGAAFGAD
DCVRFSYATDMDTIKQGLAELERFVSTLA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcgactaacccagcgagttagccaagttgtgccttccatcacccttgaaattacggca
aaggccaaggcaatgcggactgagggcattgatgtgcttagctttaccgctggggaaccg
gattttaccactcccccccacattgtggaggcggccaaattagccttggatgaagggaag
acccgctatggccccgccgccggagaaccggccctccgtcaggcgatcgccaaaaagtta
cgggaaaagaataatttgccctacgaggcggccaatattttggtgaccaatgggggtaaa
cattccctgtttaacctaatgctagccatgattgagcagggggatgaggtaattattccc
gccccctattggctcagttatccagaaatggtgcgtttagccgaaggaaccccagttatt
gtcaacaccacagcggccacggattacaaaatcaccccagagcaactacggcaggccatt
acctccaaaagtaagctgtttgtgctgaattctccttccaatcccaccggggcagtttac
actcctgccgaaattagggctttggcggcggtgattttggaatatgaggatttatacgta
gtttccgatgagatttatgagcgcattctctacgatggcacagagcacctcagcattggt
gcggtgaacgacgagattttccaacgcaccatcattagtaacggttttgccaaaagttat
tccatgaccggttggcgggtgggttacctggcgggggaattacccttaatccaagcctgt
agcaccatccagggccatagcacctccaacgtttgtacctttgcccagtacggggcgatc
gccgctctggaaaatccccaaacctgtgtggagaccatggtcaaagccttcacagaaaga
cgacaggtgatagtggaaggcatcaatcaaattgcagggctgagttgtcctaatccgaaa
ggagcattttatgtttttgtggacattgctaaaacggggcttaattccctggagttcagt
gcccgattattagaatcccaccaggtggcggtgattcctggagcggcgtttggagccgat
gactgtgtgcgtttttcctacgctaccgatatggacaccattaaacagggtttggccgag
ttagagcggtttgtcagcactttggcttga

DBGET integrated database retrieval system