KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2297Help
Entry
SYNGTS_2297       CDS       T02098                                 

Gene name
aspC
Definition
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy00220  Arginine biosynthesis
syy00250  Alanine, aspartate and glutamate metabolism
syy00270  Cysteine and methionine metabolism
syy00330  Arginine and proline metabolism
syy00350  Tyrosine metabolism
syy00360  Phenylalanine metabolism
syy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syy00401  Novobiocin biosynthesis
syy01100  Metabolic pathways
syy01110  Biosynthesis of secondary metabolites
syy01130  Biosynthesis of antibiotics
syy01210  2-Oxocarboxylic acid metabolism
syy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SYNGTS_2297 (aspC)
   00270 Cysteine and methionine metabolism
    SYNGTS_2297 (aspC)
   00220 Arginine biosynthesis
    SYNGTS_2297 (aspC)
   00330 Arginine and proline metabolism
    SYNGTS_2297 (aspC)
   00350 Tyrosine metabolism
    SYNGTS_2297 (aspC)
   00360 Phenylalanine metabolism
    SYNGTS_2297 (aspC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYNGTS_2297 (aspC)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SYNGTS_2297 (aspC)
Enzymes [BR:syy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     SYNGTS_2297 (aspC)
Amino acid related enzymes [BR:syy01007]
 Aminotransferase (transaminase)
  Class I
   SYNGTS_2297 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-ProteinID: BAK51045
Position
complement(2557637..2558806)
Genome map
AA seq 389 aa AA seqDB search
MRLTQRVSQVVPSITLEITAKAKAMRTEGIDVLSFTAGEPDFTTPPHIVEAAKLALDEGK
TRYGPAAGEPALRQAIAKKLREKNNLPYEAANILVTNGGKHSLFNLMLAMIEQGDEVIIP
APYWLSYPEMVRLAEGTPVIVNTTAATDYKITPEQLRQAITSKSKLFVLNSPSNPTGAVY
TPAEIRALAAVILEYEDLYVVSDEIYERILYDGTEHLSIGAVNDEIFQRTIISNGFAKSY
SMTGWRVGYLAGELPLIQACSTIQGHSTSNVCTFAQYGAIAALENPQTCVETMVKAFTER
RQVIVEGINQIAGLSCPNPKGAFYVFVDIAKTGLNSLEFSARLLESHQVAVIPGAAFGAD
DCVRFSYATDMDTIKQGLAELERFVSTLA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcgactaacccagcgagttagccaagttgtgccttccatcacccttgaaattacggca
aaggccaaggcaatgcggactgagggcattgatgtgcttagctttaccgctggggaaccg
gattttaccactcccccccacattgtggaggcggccaaattagccttggatgaagggaag
acccgctatggccccgccgccggagaaccggccctccgtcaggcgatcgccaaaaagtta
cgggaaaagaataatttgccctacgaggcggccaatattttggtgaccaatgggggtaaa
cattccctgtttaacctaatgctagccatgattgagcagggggatgaggtaattattccc
gccccctattggctcagttatccagaaatggtgcgtttagccgaaggaaccccagttatt
gtcaacaccacagcggccacggattacaaaatcaccccagagcaactacggcaggccatt
acctccaaaagtaagctgtttgtgctgaattctccttccaatcccaccggggcagtttac
actcctgccgaaattagggctttggcggcggtgattttggaatatgaggatttatacgta
gtttccgatgagatttatgagcgcattctctacgatggcacagagcacctcagcattggt
gcggtgaacgacgagattttccaacgcaccatcattagtaacggttttgccaaaagttat
tccatgaccggttggcgggtgggttacctggcgggggaattacccttaatccaagcctgt
agcaccatccagggccatagcacctccaacgtttgtacctttgcccagtacggggcgatc
gccgctctggaaaatccccaaacctgtgtggagaccatggtcaaagccttcacagaaaga
cgacaggtgatagtggaaggcatcaatcaaattgcagggctgagttgtcctaatccgaaa
ggagcattttatgtttttgtggacattgctaaaacggggcttaattccctggagttcagt
gcccgattattagaatcccaccaggtggcggtgattcctggagcggcgtttggagccgat
gactgtgtgcgtttttcctacgctaccgatatggacaccattaaacagggtttggccgag
ttagagcggtttgtcagcactttggcttga

DBGET integrated database retrieval system