KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2300Help
Entry
SYNGTS_2300       CDS       T02098                                 

Gene name
slr0440
Definition
(GenBank) hypothetical protein
  KO
K19707  
sigma-B regulation protein RsbQ
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
Transcription machinery [BR:syy03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     SYNGTS_2300 (slr0440)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2560873..2561676
Genome map
AA seq 267 aa AA seqDB search
MEKYNIQVLGNVNSQETLVFAHGFGSEQNAWRSIYPAFEENYRIVLFDFPGSKPANSKDF
DIQNYNSLKDYADDLMEIAHLAGVRQGILIAHSASCMIGVLASLRDPNLFKGMVFICGSP
RYRDDGDYKGGFSQEKIATILNEMSHNYAEWIRTYAPAAVNDPNKPELVEEFSHCLLQLR
PDIGLVVFSLIIMSDYRREVAQVEIPTLIVQPQEDIFVPPTVGAYLYRIMKNSELYWIDT
PGHFPHLANPTEITKAIADYLQENEFV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatacaacatccaagttttaggtaatgttaattcccaagaaaccttagttttt
gcccatgggtttgggagtgaacaaaacgcttggcgctctatctatccggcctttgaagaa
aattatcgcattgttttatttgactttcctggcagtaaacccgctaatagcaaagatttt
gatattcaaaattacaattccctcaaggattatgccgatgatttgatggagatcgcccat
ttggcaggggtgcgtcagggaattctaattgcccactctgctagttgcatgattggggtg
ctagccagtttgcgggatccgaatttgtttaagggcatggttttcatttgtggttccccc
cgctatcgggatgatggggattataaaggcggttttagccaagaaaaaatcgccacaatt
ctcaatgaaatgagccataactatgccgagtggattcgcacctatgccccggcggcggtt
aatgatcccaacaagccagaattggtggaagaattttcccattgtcttttgcaactgcgt
cctgacattggcttggtggtatttagtctcatcatcatgtccgattaccgtcgggaggtg
gcccaggtggagatcccgaccttaatcgtgcaaccccaggaggacatttttgtgccgccc
acagtgggggcttatctttacaggattatgaaaaatagtgaactttattggattgatact
ccggggcattttccccatctggctaacccaacggaaatcaccaaggcgatcgccgattat
ttacaggaaaatgaattcgtttaa

DBGET integrated database retrieval system