KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2301Help
Entry
SYNGTS_2301       CDS       T02098                                 

Gene name
slr0049
Definition
(GenBank) hypothetical protein
  KO
K00290  
saccharopine dehydrogenase (NAD+, L-lysine forming) [EC:1.5.1.7]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Lysine biosynthesis
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SYNGTS_2301 (slr0049)
   00310 Lysine degradation
    SYNGTS_2301 (slr0049)
Enzymes [BR:syy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.7  saccharopine dehydrogenase (NAD+, L-lysine-forming)
     SYNGTS_2301 (slr0049)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2561770..2562966
Genome map
AA seq 398 aa AA seqDB search
MAKVMIVGAGGVGSVVAHKCAALEDFTDILLASRTVAKCDQIAAHIGSPKVKTAALDAFQ
VSDTVKLLQDFGADLLINVALPYQDLVLMDACLEAGVDYLDTANYEPPDVAKFEYSWQWA
YQDKFKDAGLMALLGCGFDPGVTGVFTAYALKHHFDEIHYLDIVDCNAGNHGQAFATNFN
PEINIREITQKGRYHEDGVWQEIDPLSVHRDINYPHIGDRPSYLLYHEELESLVKNIPTL
KRARFWMTFSEAYINHLRVLEAVGMTRIDEVEYQGQKIVPLQFLKAVLPEPASLAENYSG
QTSIGCYIKGVKDGQAKTYYIYNNCDHAVCFAEVGSQAISYTTGVPAALGGLMMVQGKWK
QAGVFNVEEMDPDPFLAKLGEMGLPWHEVVNGPFPFDD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagtaatgattgtgggagctgggggcgtgggcagtgtggtggcccacaaatgc
gcggctttagaggactttacagacattcttctggctagtcgcacggtggccaaatgtgat
caaattgcggctcacattggttcccccaaggttaaaactgctgccctggatgcttttcag
gttagtgacacggtcaaactcctacaggactttggggccgacttgctcattaacgtggct
ttgccctaccaggacttggtgttgatggatgcttgcttagaagcgggggtggattacctc
gacaccgctaattacgagcctcccgacgtggccaagtttgaatatagttggcagtgggct
taccaagacaagtttaaggatgccgggttaatggctctgttgggttgtggctttgaccca
ggggtaacgggagtttttactgcctatgccctcaagcaccattttgatgagatccattac
ctagacattgtggattgtaatgcggggaaccatggtcaggcctttgccaccaatttcaac
ccagagattaatattcgcgaaattacccaaaagggccgttaccacgaagatggggtttgg
caggaaattgatcccctttccgttcaccgggatattaactatccccacattggcgatcgc
ccttcctatttgctctaccacgaggaattggaatccctggtgaaaaatattcctaccctg
aaacgggcccgcttttggatgaccttttcggaagcttacattaaccatctgcgggtgctg
gaggcggtgggtatgacccgcattgatgaagtggaataccaggggcaaaaaattgtcccc
ctacaatttctcaaggctgtgttaccggaacccgcttccttggcggaaaattattcgggg
caaacctccattggttgctacatcaagggcgttaaagatggtcaagccaaaacctattac
atctacaataactgcgaccatgctgtctgttttgccgaagtaggctcccaggccatttcc
tacaccaccggagtgcccgccgcgttggggggactgatgatggtacagggcaaatggaag
caagcaggggtattcaatgtggaagaaatggaccccgatccgttcctcgccaaattgggg
gaaatgggtttgccctggcacgaagtagtcaacggcccttttccttttgacgattag

DBGET integrated database retrieval system