KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2303Help
Entry
SYNGTS_2303       CDS       T02098                                 

Gene name
slr0050
Definition
(GenBank) hypothetical protein
  KO
K00784  
ribonuclease Z [EC:3.1.26.11]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
Enzymes [BR:syy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.11  tRNase Z
     SYNGTS_2303 (slr0050)
Transfer RNA biogenesis [BR:syy03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    SYNGTS_2303 (slr0050)
 Prokaryotic Type
    SYNGTS_2303 (slr0050)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2563282..2564262
Genome map
AA seq 326 aa AA seqDB search
MEITFLGTSSGVPTRNRNVSSIALRLPQRAELWLFDCGEGTQHQFLRSEVKISQLTRIFI
THLHGDHIFGLMGLLASSGLAGSGQGIEIYGPEGLGDYLEACCRFSSTHLGKRLKVHTVR
ENGLIYEDKDFQVHCGLLKHRIPAYGYRVEEKQRPGRFNVEQAEALGIPFGPIYGQLKQG
KTVTLEDGRRIRGQDLCEPPEPGRKFVYCTDTVFCEEAIALAQEADLLVHEATFAHQDAQ
LAFDRLHSTSTMAAQVALLANVKQLIMTHFSPRYAPGNPLQLENLLAEAQAIFPNTRLAR
DFLTVEIPRRTADPAIAMSTPQASPA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtggaaattacttttcttggtaccagctccggcgttcccacccgtaaccgcaatgtttcc
agcattgccctccgtttaccccaaagggcggaattgtggttatttgattgcggagaaggc
acccaacaccagtttttgcgcagtgaagtcaaaatttcccaattgacccgcattttcatt
acccatctccacggcgaccacatttttgggctgatgggtttattggctagctccggttta
gctggctccggtcaaggtattgaaatttatggcccagagggcttgggggattatttagaa
gcctgttgccgtttttctagtacccacctgggcaaacgcctcaaagttcacactgtccga
gaaaatgggctaatttacgaagataaggattttcaagtccactgcggtttactaaaacat
cgcattccggcctatgggtatcgagtggaggaaaagcaacggccagggcgtttcaatgtg
gagcaagcggaagctttgggcattccctttggtcctatttacggccagttaaaacaggga
aaaaccgtcaccctggaagatggtcgccgaattcgaggtcaggacctctgtgaaccaccg
gaaccgggccggaaatttgtttactgtactgatacggtcttttgtgaagaggcgatcgcc
ttggcccaggaagcagatttgctggtacatgaagccacttttgcccatcaggatgcccag
ctagcctttgaccggctccattccacttccaccatggcagcccaggtagctttgttggcc
aatgtcaagcagttaatcatgacccatttcagcccccgctatgcccccggcaatcccctg
caactggaaaatctactggcggaagcccaagctatttttcccaatacccgtttggctagg
gattttttaacggtggaaattcctcgccgcacagccgatcctgccatcgcaatgtcaacc
cctcaggcatcccctgcatag

DBGET integrated database retrieval system