KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2306Help
Entry
SYNGTS_2306       CDS       T02098                                 

Gene name
purU
Definition
(GenBank) phosphoribosylglycinamide formyltransferase
  KO
K01433  formyltetrahydrofolate deformylase [EC:3.5.1.10]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy00630  Glyoxylate and dicarboxylate metabolism
syy00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SYNGTS_2306 (purU)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SYNGTS_2306 (purU)
Enzymes [BR:syy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.10  formyltetrahydrofolate deformylase
     SYNGTS_2306 (purU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N ACT ACT_4 ACT_6
Motif
Other DBs
NCBI-ProteinID: BAK51054
Position
complement(2566054..2566908)
Genome map
AA seq 284 aa AA seqDB search
MQNLTATLLVSCPDQPGIVAQIAQFIYQNQGNIIHADQHTDFSSGLFLNRVEWQLDNFRL
SRPELLSAWSQLAEQLQATWQIHFSDQLPRLALWVSKQDHCLLDILWRWRSGELRCEIPL
IISNHPDLKSIADQFGIDFHCLPITKENKLAQETAELALLKQYQIDLVVLAKYLQILTTD
FVVQFPNIINIHHSFLPAFPGANPYHRAHERGVKIIGATAHYATAQLDEGPIIEQDVVRV
SHRDNVDDLIRKGRDLERVVLARAVRLHLQHRILVYDNRTVVFA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatctcaccgcaacactgcttgtttcctgtcctgaccaaccgggcattgtggcc
caaattgcccagtttatttatcaaaaccagggcaatattatccatgccgaccagcacacg
gacttctccagtggactttttttaaatcgggtggagtggcagttggacaattttcgccta
tcccgtccggagttgttatccgcttggtcccaattggctgagcaactccaagctacttgg
caaattcatttttctgaccagttgccccggttagccctctgggtgtccaagcaagaccat
tgtctgctcgatattctctggcgttggcgatcgggagagttgcgttgtgaaattcccctc
attattagtaatcatcctgacctcaaatccattgctgaccaatttggcattgatttccat
tgtttacccattacgaaagagaataaattagctcaggaaacggccgaattggctttgttg
aaacagtaccaaattgatctagtggtgttagcaaaatatctacaaattttaaccacggat
tttgtggttcaatttcccaacattattaatattcaccactcttttttaccggcttttccc
ggcgctaatccctaccatcgtgcccatgagcggggcgtaaaaatcattggagccaccgcc
cactatgccaccgcccaattggatgagggtccaattatcgagcaggatgtggtcagggtt
agtcaccgggataatgtggacgatttaattcgtaagggaagagatttagaaagggtggtg
ctggctagggccgtgcgtttacatttgcaacatcgaattcttgtttatgataaccgcact
gtggtgtttgcttaa

DBGET integrated database retrieval system