KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2310Help
Entry
SYNGTS_2310       CDS       T02098                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SYNGTS_2310 (gst)
Enzymes [BR:syy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SYNGTS_2310 (gst)
Transporters [BR:syy02000]
 Other Transporters
  Pores ion channels [TC:1]
   SYNGTS_2310 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2572466..2573020)
Genome map
AA seq 184 aa AA seqDB search
MIKLYGAPQSRASIIQWYLEELSLPYEFVNVNLKEGEHRQAPYLAINPFGKVPAIADGNF
HLWESGAILLYLAEKASTIPADAQARALVNQWILFANSTLANGLFIEAVREKEMPRLLQS
LEKILGRSPFILGEKFSVVDVAVGSILAYVPIMLKLNFDDYPAVAAYVQGLVQRPAFQAS
IGAR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaactatacggtgccccccaaagtcgagcctccatcattcagtggtacttagaa
gaattatccctgccctacgaattcgtcaacgttaacctcaaggaaggggaacatcgccaa
gctccctatttagccattaatccctttggtaaggtgccggcgatcgccgatgggaacttt
catctctgggaatccggtgcaattttgctttacttagcggaaaaagctagcaccattccc
gccgatgcccaggccagagctctagttaaccagtggattttatttgccaattccaccctg
gccaatggtttatttattgaagcagtgcgggaaaaggaaatgccccgactgttgcaatct
ttggagaaaattttagggcgatcgccatttatcctcggagaaaaattttcggtggtggat
gtggccgtcggttcaattttggcctatgtccccatcatgctcaaacttaattttgacgac
tatcctgcggtggcggcctacgtccagggcctagtgcaacgaccggctttccaagcttcc
atcggtgcccgctga

DBGET integrated database retrieval system