KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2314Help
Entry
SYNGTS_2314       CDS       T02098                                 

Gene name
slr0053
Definition
(GenBank) hypothetical protein
  KO
K07042  
probable rRNA maturation factor
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
Ribosome biogenesis [BR:syy03009]
 Prokaryotic Type
  Other maturation factors
   SYNGTS_2314 (slr0053)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2575102..2575641
Genome map
AA seq 179 aa AA seqDB search
MAPTSVNKIAVELSLQTDLTGSAMASSGVEELLTNPWQGWCQRWLEYLADCLPPASSYEL
TLLFTGDRRIQELNRKFRHQDKPTDVLAFAALEGDFPLIESEETEEPLYLGDIVISLERA
DHQARERGHSAKLEVVWLTAHGLLHLLGWDHPDEASLTTMLSEQSHLLTLIGQNPPLFT
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcccctacctctgttaacaagattgcggtggaattaagcttacaaactgatttgact
ggttccgccatggcgagttcaggggtggaagagttactaaccaatccctggcaagggtgg
tgtcaacgctggctggaatacctggcagattgtcttccccccgcctccagctacgaactc
accttactattcaccggcgatcgccgtatccaagagttaaatcgtaaatttcgccaccag
gataagcccaccgacgtgttggcttttgcggccttagaaggagattttcccttaatagaa
tctgaagaaacggaggaacccctttatttgggtgatatagtgatctccctagaacgggct
gaccatcaggctagggaacggggccatagtgcaaaattagaagtcgtgtggttaacggcc
cacggcctactccatctcctcggttgggatcaccccgacgaagcctccctcaccaccatg
ttgtccgaacaatcccatctattaactttaatcggccaaaatcctcccctattcacctaa

DBGET integrated database retrieval system