KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2318Help
Entry
SYNGTS_2318       CDS       T02098                                 

Gene name
sll0064
Definition
(GenBank) hypothetical protein
  KO
K02030  
polar amino acid transport system substrate-binding protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
Transporters [BR:syy02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    SYNGTS_2318 (sll0064)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2578125..2578952)
Genome map
AA seq 275 aa AA seqDB search
MLLKSAFTWLALTFTTGLVAIAPVQAETVLERVARTGELRAGTRTDAVPFGFEMANGEME
GYGVDLMALIALKLAEEMGKTITVDLDRVDLQSRFEAIASGELDIVCEATTITQDRLELV
DFSAPFFISGAKFLMKQGSVEGFNINGTLEGIPIAYIQNTTTFDIIPKIYPLAQWVPVQD
REEGIAKLDGGQVKAVVSDGILLVGELLKQGKNPAEYALGPYQPITTELYACILPQGDGD
WKRFVDEVISSTENHDLLQEWFNIDQTNVVRVDPL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcaaaagtgcttttacttggttggctttgacctttaccactggcctggtggcg
atcgccccggtccaggcggaaactgtgttggagagggtggcccgcacgggggaattacgg
gctggaacccgcaccgatgctgtcccgtttggttttgagatggccaatggggaaatggag
ggttatggggttgatttaatggccttaattgccttgaagttggcagaagagatgggtaag
accattacggttgatttagatagggttgacctccagagtcgttttgaggcgatcgccagt
ggggaattggatatagtttgtgaagccaccaccattacccaagatcggttggaattagtg
gatttttcagctccattctttatttccggggccaagtttttgatgaaacaaggcagtgtg
gagggctttaacattaatggcaccctggagggcattcccattgcctacattcaaaacacc
accacctttgatatcatccccaaaatttatcccctagcccagtgggtgccagtgcaagac
cgggaggaaggcattgctaaattggatgggggccaggtgaaggccgttgtcagcgatggc
attttgctagtgggggaactgcttaaacagggcaaaaacccagctgaatacgctctagga
ccttatcaacccattaccacggaactttacgcttgcattctgccccagggggacggagac
tggaaacgctttgtggatgaagtaatttctagcacggaaaaccatgatttgctccaggaa
tggttcaacattgaccaaaccaatgtggtgcgggttgatcccctttag

DBGET integrated database retrieval system