KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2329Help
Entry
SYNGTS_2329       CDS       T02098                                 

Gene name
gspE
Definition
(GenBank) general secretion pathway protein E
  KO
K02652  
type IV pilus assembly protein PilB
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
Secretion system [BR:syy02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   SYNGTS_2329 (gspE)
Bacterial motility proteins [BR:syy02035]
 Pilus system
  Pilus assembly proteins
   SYNGTS_2329 (gspE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2588668..2590686
Genome map
AA seq 672 aa AA seqDB search
MTSSSSSKKSRAVALRNYFSPFGNKLVAGGHVDAEQLRQALVQVKKTGRSLPEELKAVTG
RELSPELLRQYKKNQLFELKVLYGVDSVDPEVAPIATQQMAELIGRFFPLDTCRRFKFLP
LAQQEGDPPSVLVAMVDPDNLAAQDELNRILRVKGFELRRLVVTQDDFNQLLEQYYAIRE
EWEAAQEKRDQERALDKLNDLTDIVGSIDMNLGEDKEDVDNALDSNDANQAPVINLVNKI
LAKALQEGTSDIHVEPQEETLRIRFRKDGVLNQAFDPLPRKITPAVVARFKIMADMDIAE
RRSPQDGKIRRIYQGRKVDFRVNTLPSRYGEKVCLRILDNSATQLGLDFLITNPETLQTV
RELAARPYGLMLVTGPTGSGKSTTLYSVLAERNSPEVNINTAEDPIEYALPGITQVQVIR
EKGMDFSNILRAFMRQDPDVILVGETRDKETAKTAIEAALTGHLVLTTLHTNDAAGAIAR
LDEMGVEPFMVSGSLLGVLAQRLMRKVCTECRIAYHPSKEELSRFGLSASGDEVVTFYKA
NSLSPDEIHLARQKGNLCQKCSGSGYKGRVGVYEVMRNSERIAELINQGATTDRIKDCAV
EEGMITLLAYSLNLVQEGYTTLEEVERVTFTDTGLESEMRAKRKSALTCRTCAAELQQEW
LDCPYCMTSRFS
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgacatcttcctcctcttccaagaaaagccgtgccgttgccctacgaaattatttttcc
cccttcggcaataaattggtggcggggggccatgtagatgctgaacaattgcgacaggcc
ctagtccaggtgaaaaaaactgggcggtctttgcccgaggaacttaaggcagtcactggc
cgagaattgtccccagaactactgcggcagtacaaaaaaaatcagttatttgagctcaaa
gtactttacggggtggacagcgtcgatccggaggttgccccgatcgccacccagcaaatg
gccgagttgattgggcgattttttcctttggatacttgtcggcgattcaagtttttgccc
ttagcccagcaggaaggcgacccccccagtgtgctagtggccatggtggaccccgataac
ttggctgcccaggacgagctaaaccgaattttgcgggttaaaggttttgaattgcgccgc
ttggtggtcacccaagatgattttaaccaactgttggaacagtactatgccatccgggaa
gagtgggaggcggcccaggaaaaaagggaccaggaaagggcccttgataaacttaatgat
ttgacggatattgtcggctccatcgacatgaatctgggggaggacaaagaagatgtagat
aatgctctagactccaacgatgctaaccaagcaccggtgattaacctggtcaacaaaatt
ttggctaaggctctccaggaaggaacttccgacattcacgtggagccgcaggaagaaacc
ctgagaattcgtttccgcaaggatggggttttaaatcaggctttcgatcccctgccccgc
aaaattacccccgccgtggtggcccgttttaaaattatggcggacatggacattgcggag
aggcgatcgccccaggatggcaaaattcgccgtatttaccagggcaggaaggtggatttt
cgggttaataccctacccagccgctatggggaaaaggtttgtttgcggattttggacaac
tccgccactcagttgggcttagattttctaatcactaaccccgaaaccctacaaacggta
agggaattggccgcccggccctatggcttaatgttggtgacggggcccaccggatcggga
aaatccaccaccctctactcggtgttggcggaacgcaatagccccgaggtgaatatcaac
acagcggaggacccgattgagtatgctctaccgggcattacccaagtgcaggtgattcgg
gaaaagggcatggatttttccaatattctgcgggcatttatgcgtcaggatcccgatgtg
attctggtgggggaaaccagggataaggagacggccaaaacggccattgaggcggctctg
actggacacttagttctcactactctccacaccaatgatgcggccggggcgatcgccaga
ttggatgaaatgggagtggagccgtttatggtttctgggtcattgttgggggtgttggcc
caacggctgatgcggaaagtttgtacggaatgtcgcattgcttaccaccctagcaaggaa
gaattgtcccgctttgggctgtccgcttccggggatgaagtggttactttttataaagcc
aattccctcagtcccgacgaaatccatcttgcccgtcaaaaaggtaatttatgtcaaaaa
tgtagtggcagtggctataagggtcgggtgggggtctatgaggtgatgcgtaattctgag
cgtattgctgaattgattaaccagggggccaccactgaccgcattaaggattgtgcggtg
gaagagggcatgatcaccctattggcctatagtcttaatttagtgcaggaaggctacacc
accctagaggaggtggaacgggtcactttcaccgataccggactggagtcagaaatgcgg
gctaagcgcaagagtgctttaacctgtcgtacgtgtgcggcggaactgcaacaggaatgg
cttgattgtccctattgcatgacttcccggtttagctaa

DBGET integrated database retrieval system