KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2331Help
Entry
SYNGTS_2331       CDS       T02098                                 

Gene name
slr0065
Definition
(GenBank) hypothetical protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2592146..2592784
Genome map
AA seq 212 aa AA seqDB search
MTDRRQYAPATQRNRETIAAVLQEYLPSQGSILEIASGTGEHACFFAPLFSPRWWITSDP
DPLCRESIMAWRDHQALANFQSPLDLDVNDQVWPVEREILREPVTSIVAINLIHISPWES
CLGLLTGAERILPEGGILYLYGPYRQKGVPTAPSNEAFDQSLQSRNPAWGLRQLEDVIGE
AGKRNLHNQAIIPMPANNLSVIFQKGSGQNSG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgccgtcagtatgctcccgctacccaacgcaaccgagagacgatcgccgct
gttttgcaggagtatctcccctcccaaggcagtattttagaaattgccagtggcaccggg
gaacatgcttgcttttttgcgcccctattttccccccgttggtggattacgtctgaccca
gaccccctttgccgggaaagtatcatggcctggcgagaccatcaagcattggccaatttt
cagtcacctttggatttggacgttaatgaccaggtttggccagtggagcgagaaatatta
cgggaacccgttactagtattgtggccatcaacttgattcatatttccccctgggaatcc
tgcttagggttactaactggggcagaacgcattttgccggaggggggcatcctctatctc
tacggcccttaccgccaaaagggagtaccaacggctcctagcaatgaagcgtttgatcaa
tcgttgcaaagtcgtaacccagcttggggtttgaggcagttggaagatgtgattggggaa
gcgggaaagagaaatttacacaatcaagcaataattcccatgcctgctaacaatttatcg
gtaattttccagaaggggtcagggcaaaattctggttaa

DBGET integrated database retrieval system