KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2334Help
Entry
SYNGTS_2334       CDS       T02098                                 

Gene name
slr0067
Definition
(GenBank) ATP-binding protein involved in chromosome partitioning MRP
  KO
K03593  
ATP-binding protein involved in chromosome partitioning
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
Chromosome [BR:syy03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    SYNGTS_2334 (slr0067)
Mitochondrial biogenesis [BR:syy03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    SYNGTS_2334 (slr0067)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2595604..2596665
Genome map
AA seq 353 aa AA seqDB search
MLTTDAVLTVLRPVQDPELQKSLVELNMIRDVAIAGGTVSFTLVLTTPACPLREFIVEDC
EKAVKTLPGVEKVEVKVTAETPQQKSLPDRQSVGQVKNIIAISSGKGGVGKSTVAVNVAV
ALAQTGAAVGLLDADIYGPNAPTMLGLSGAAVQVQNSPQGEVLEPVFNHGIKMVSMGFLI
DPDQPVIWRGPMLNGIIRQFLYQVNWGALDYLIVDMPPGTGDAQLTLTQSVPMAGAVIVT
TPQTVSLLDARRGLKMFQQMGVNVLGIVENMSYFIPPDLPDRQYDLFGSGGGEKASKELN
VPLLGCVPLEIGLREGGDKGVPIVVSQPESASAKALTAIAKQIAGKVSMAALV
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgctaaccaccgatgccgttttaactgtactccgtcccgttcaagaccccgaactacaa
aaaagcttagtggaactgaacatgatccgggatgtggcgatcgccgggggcactgttagt
ttcaccctggtgttgaccacaccggcctgtcctttgcgggaattcattgtggaggattgc
gaaaaggcggtgaaaactttgccgggggtggaaaaggtggaagtaaaggtgacggcggaa
accccccagcaaaaatccttgcccgatcgccaatcggtgggacaagtgaaaaatatcatt
gccatctccagcggcaaagggggagtggggaaaagcactgtggcggtgaatgtggccgtg
gccctggcccaaactggagcggcggtgggactattggatgcagacatttatggtcccaat
gcccccaccatgttaggtctaagcggtgcggcggtacaggtgcaaaatagcccccagggg
gaagtgctggagccagtgtttaaccatggcatcaaaatggtttccatgggctttttaatt
gatccagaccaaccagtaatttggcggggccccatgttgaacggcattatccgtcagttc
ctctaccaagttaattggggagccttggattacctgatcgtggatatgccccccggtacc
ggcgatgcccagcttaccctaactcaatcggtgcccatggccggtgcagtcattgtcacc
accccccaaactgtctctttgttggatgcccgccggggtttgaaaatgttccaacaaatg
ggggtaaacgtgttgggcattgtggaaaatatgagctactttattcctccggatctgccg
gatcgccaatatgatctcttcggttccggcggcggcgaaaaagcttccaaggaattgaat
gtacccctattgggctgtgtcccgttggaaattggcctacgggaggggggagacaaaggc
gttcccattgtggtttcccagcccgaatcagcctcggccaaagccctcacggcgatcgcc
aaacaaattgccggcaaggtttccatggcagccctggtttag

DBGET integrated database retrieval system