KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2336Help
Entry
SYNGTS_2336       CDS       T02098                                 

Gene name
slr0069
Definition
(GenBank) hypothetical protein
  KO
K09932  
uncharacterized protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
2598132..2598791
Genome map
AA seq 219 aa AA seqDB search
MTSPPTPDQAADEYFEYHFAHRVTPDHHEIFLECQEQLKILVTKYPGYISSESTELRSEG
DIFVAETVIRFDTLENFMGWIDSPERRQLIYLEENAGYQFEGKVNTEGYSRWLKRKLSKP
SPVWKINLLVLLVLYPTVMGFNLLFRKPDFIDFPTWMLFGNFCSVSITGWFAVPWVSGIY
QRWLEGQGTKKEQALALVTIILALLLLLQFFRVIFQQLA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacttccccaccaactccagaccaggccgccgatgagtattttgagtatcattttgcc
catcgggtcaccccggaccaccacgaaatttttctggaatgccaagaacagttaaaaata
ttagtaacaaaatatcctggttatattagcagtgaatccacggaattaagatctgaaggg
gatatttttgtagcggagactgtaatccgttttgatacactggaaaactttatgggctgg
atagatagcccggaaagaaggcaactaatttacctagaagaaaatgctggttatcagttt
gaaggtaaagttaatacggaaggttacagtcgttggctaaaacgcaagttgagcaaacct
tcccctgtgtggaaaatcaatcttttggtgttgttggtgctttatcccactgtgatgggc
tttaacctattattccgtaaaccggattttatcgactttcccacctggatgctatttggt
aatttttgtagcgtctctatcacgggttggtttgcggtaccttgggtcagtggcatttat
caacgctggctagaaggtcaaggcacaaaaaaagagcaagcactggctttagtaaccatt
attcttgccctgcttttactactgcaatttttccgggtaattttccaacaattggcctaa

DBGET integrated database retrieval system