KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2338Help
Entry
SYNGTS_2338       CDS       T02098                                 

Gene name
fmt
Definition
(GenBank) methionyl-tRNA formyltransferase
  KO
K00604  
methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
One carbon pool by folate
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SYNGTS_2338 (fmt)
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SYNGTS_2338 (fmt)
Enzymes [BR:syy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.9  methionyl-tRNA formyltransferase
     SYNGTS_2338 (fmt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2599522..2600514
Genome map
AA seq 330 aa AA seqDB search
MMKTVFFGTPDFAVPTLEALLGHPDIDVLAVVSQPDRRRGRGSKLIPSPVKEVAVQAGIP
VWQPERVKRCQETLAKLKNCQADFFVVVAYGQLLSPEILVMPRLGCVNVHGSLLPKYRGA
APLQWAIANGETETGVTTMLMDEGMDTGAMLLKTTTPIGLMDNLTAIGDRLARSGAELLV
QTLKDLDAGQLQPIPQTETEATYAPLLKKGDFVINWHRSALEIHNQVRGFAPACHTAWGE
QILKIISTVPLGAEFFPLLPEKYQDLATAYLNYSLEAGEPGNIIGTIKNWGPVLETGNGH
LLLEQVQPPGKKPQSGWDFINGNRSTISFA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaactgttttctttggtacaccagattttgctgttcctaccctggaagctctt
ttggggcacccggatattgatgtgttggcggtggtgagccagcccgatcgccgtcggggt
agggggagtaagttaatcccttccccagttaaagaagtcgcagtacaagccggtattcct
gtgtggcaaccggaacgggtcaaacgatgccaagaaaccttagctaagttaaaaaattgc
caagcggatttctttgtggtggtggcctatgggcagctactttccccagaaattttggtc
atgccccggctgggatgtgtcaatgtccatggatccctcttacccaaatatcgtggggct
gctcccctgcaatgggcgatcgccaacggagaaacggaaaccggagtcaccactatgctg
atggacgaaggcatggacaccggggccatgctgctgaaaactactacccccattggctta
atggataacctaacggcgatcggcgatcgattggctaggtcgggggcggaattgttagtg
caaaccctaaaggatttagatgcaggccaactgcaacccattccccaaactgaaacggaa
gccacctatgccccactgctgaaaaaaggggattttgtcattaattggcaccggagtgcc
ctggaaatccataaccaagtgcggggttttgcaccggcgtgccacacagcttggggagag
cagattttgaaaataattagcactgttccccttggagctgaattttttcccctcttgccg
gaaaagtatcaagatttagccaccgcctacctaaattactcattagaagcgggggaacca
ggcaatataatcggcaccatcaaaaattggggacctgttttggaaaccggcaacggccac
ctattattggaacaagttcaacccccaggcaaaaagccccaaagcggttgggatttcatc
aacgggaaccggagcaccattagcttcgcctaa

DBGET integrated database retrieval system