KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2340Help
Entry
SYNGTS_2340       CDS       T02098                                 

Gene name
slr0468
Definition
(GenBank) hypothetical protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2601289..2602599
Genome map
AA seq 436 aa AA seqDB search
MALPSKFNLTLGFWKPIWAIPRKFKSKLLFSNFKSVVPSTMSNKIPKNRTRTFDLTPGEK
PDMSPYLFHLTTKDSLINILEQQKLILNIPRGANKEKHPYKMVCFTESPPFALDFFRYRW
SDRKDRINLEYGLGFSKETMVHKGVYPTVYLDESLFSYVKDLKKRVDGSQKSTNEMKKEM
ELLIAQISPLFENADLRGYTWEREWRCTRGDSLEFDYVDIRYICCPRAEQEAIRKIIEDS
NEVEAIQHIQFLENWQEYDEITTFLQRRQFTGDDELEELLAEKCRTNNLINYYNSHYKKI
DELKTHLNQVVNYINNKKEEIQDSINREAILEYIAENFGEESIEGGVKSIINDGSIDLGL
IIANVAYCVKQKVKKQVKGKKVDGEYIRRSIEENYADNQTQKERNNDNKVIEDIESGMNS
SFNSKWERIIDPLEQH
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcactcccgagcaaattcaatctgaccctagggttctggaagcctatttgggcgatt
cctagaaaatttaagtctaaactacttttttctaacttcaaatcggtggtgcctagcaca
atgtcaaacaagatccccaaaaatagaactcggacatttgacttgactcccggtgaaaaa
ccggacatgtccccctatttatttcatttgacaacaaaagacagcctaataaatattcta
gaacaacaaaaattaatattgaatatccctcgtggtgcaaataaagagaagcatccatat
aaaatggtttgttttactgaaagcccacccttcgcattagatttttttagatatagatgg
agtgacagaaaagatagaatcaacttagagtatggcttaggatttagcaaagagacaatg
gttcataaaggtgtttatcctactgtttatcttgacgaatctttgtttagttacgtcaaa
gatcttaaaaaaagagtagatggtagccaaaaatcaaccaatgaaatgaagaaggaaatg
gaacttttgatagcacaaatttcccctctatttgaaaatgcagacttacggggctataca
tgggaaagagaatggcgatgtacacgaggagattctctagagtttgattatgtcgatata
agatatatttgttgtccacgcgcagaacaagaagctatcagaaaaataatagaagattct
aatgaggttgaagctatccagcacattcaatttttagaaaattggcaggagtatgatgaa
ataaccacttttttgcagaggagacaatttactggagacgatgaattagaggaactactg
gcggaaaagtgccgtaccaacaatttaattaattattacaattcacactataaaaaaata
gatgaactgaaaactcatctcaaccaggtagtcaattacataaataacaaaaaagaagag
attcaagattcaatcaacagagaagcaatacttgaatatatagcagaaaattttggagaa
gagtcaattgaaggaggtgtaaagagtataataaatgacgggagtattgacctcggctta
attattgccaatgttgcatattgtgtcaaacagaaagtgaaaaaacaggtgaagggaaaa
aaagtagatggagaatacatacgtcgcagcatagaagaaaactatgcagataaccaaact
caaaaagaacgaaacaatgacaacaaagtgatagaggatattgaaagtggtatgaactct
tcattcaattcaaagtgggagaggataatcgacccactagaacaacattga

DBGET integrated database retrieval system