KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2344Help
Entry
SYNGTS_2344       CDS       T02098                                 

Gene name
cph1
Definition
(GenBank) cyanobacterial phytochrome Cph1/Hik35
  KO
K11354  
two-component system, chemotaxis family, sensor kinase Cph1 [EC:2.7.13.3]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Two-component system
Module
Cph1-Rcp1 (light response) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:syy00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SYNGTS_2344 (cph1)
Enzymes [BR:syy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SYNGTS_2344 (cph1)
Protein kinases [BR:syy01001]
 Histidine protein kinases
  CheA family [OT]
   SYNGTS_2344 (cph1)
Two-component system [BR:syy02022]
 CheA family
  Cph1-Rcp1 [MD:M00510]
   SYNGTS_2344 (cph1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
2606629..2608875
Genome map
AA seq 748 aa AA seqDB search
MATTVQLSDQSLRQLETLAIHTAHLIQPHGLVVVLQEPDLTISQISANCTGILGRSPEDL
LGRTLGEVFDSFQIDPIQSRLTAGQISSLNPSKLWARVMGDDFVIFDGVFHRNSDGLLVC
ELEPAYTSDNLPFLGFYHMANAALNRLRQQANLRDFYDVIVEEVRRMTGFDRVMLYRFDE
NNHGDVIAEDKRDDMEPYLGLHYPESDIPQPARRLFIHNPIRVIPDVYGVAVPLTPAVNP
STNRAVDLTESILRSAYHCHLTYLKNMGVGASLTISLIKDGHLWGLIACHHQTPKVIPFE
LRKACEFFGRVVFSNISAQEDTETFDYRVQLAEHEAVLLDKMTTAADFVEGLTNHPDRLL
GLTGSQGAAICFGEKLILVGETPDEKAVQYLLQWLENREVQDVFFTSSLSQIYPDAVNFK
SVASGLLAIPIARHNFLLWFRPEVLQTVNWGGDPNHAYEATQEDGKIELHPRQSFDLWKE
IVRLQSLPWQSVEIQSALALKKAIVNLILRQAEELAQLARNLERSNADLKKFAYIASHDL
QEPLNQVSNYVQLLEMRYSEALDEDAKDFIDFAVTGVSLMQTLIDDILTYAKVDTQYAQL
TFTDVQEVVDKALANLKQRIEESGAEIEVGSMPAVMADQIQLMQVFQNLIANGIKFAGDK
SPKIKIWGDRQEDAWVFAVQDNGIGIDPQFFERIFVIFQRLHTRDEYKGTGMGLAICKKI
IEGHQGQIWLESNPGEGSTFYFSIPIGN
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccgtacaactcagcgaccaatccctccgtcagctagaaaccctcgccatc
cacaccgcccacctgattcagccccacggtttagtggtggtcctgcaggaaccagacctc
accatcagccaaattagcgccaactgcaccggcattttagggcgatcgccagaggatttg
ttgggcagaaccctaggggaagtgtttgatagctttcagattgatcccatccagagtcgc
ctaacggccggacaaatcagcagcctcaaccccagtaaactttgggcgcgggtcatgggg
gacgactttgtcatttttgacggggtttttcatcgcaacagtgacggtttattggtatgt
gaactagagccagcctacacttccgataatctgcccttcctcggtttttatcacatggcc
aacgctgccctgaatcggttgcgccaacaagctaatctacgggatttctacgatgttatt
gtcgaagaagtccgccgtatgactggctttgaccgggtgatgctataccgctttgatgaa
aataaccacggtgatgtcattgccgaagataaacgggatgatatggaaccctatttgggc
ctgcactatcccgaatcggatattccccaacccgcccgtcggctatttatccacaacccc
attcgagtaattcccgatgtttatggtgtggcggtgcccctgaccccagcggttaacccc
agcaccaaccgagcggtggatttaacagaatccattctgcgcagtgcgtaccattgccac
ttgacctatctgaaaaatatgggggtaggagcgtctttaaccatttccctaattaaggac
ggccatctctgggggctcattgcctgccaccatcaaacccccaaagtaattccctttgaa
ctgcgtaaagcctgcgaattttttggtcgggtggtgtttagcaacatttccgcccaggaa
gatacggaaaccttcgattaccgggtgcagttggcggagcatgaagcggttttattggac
aaaatgaccacggcggcggattttgtcgaaggattaactaatcatcccgatcgcctgttg
ggattaacgggctcccagggggcggccatttgctttggggaaaaattgattttagtaggg
gaaaccccggacgagaaagcagtgcaatatttactgcaatggttggagaatcgggaagtg
caagacgttttcttcacctcttccctctcacaaatttatcctgatgcagtgaattttaaa
tccgtggccagtggcttattggccattcccattgcccgtcacaactttttgctctggttt
cgccctgaagtgttgcaaacggttaattggggcggtgacccaaatcatgcttacgaagct
acccaggaagacggtaaaatcgagctccatccccgccaatcctttgacctctggaaagaa
attgtccgactccaatctttgccctggcaatcggtggaaatccaaagtgccctggccctg
aaaaaggcgatcgtcaacctcattttgcgccaggcagaagaattggcccagttagcccgc
aacttggaacgctccaacgctgatttaaagaaatttgcctacattgcttcccatgattta
caggaaccgctcaaccaagtgagcaattatgtacaactgctagaaatgcgctacagcgaa
gctctagacgaagatgccaaagacttcatcgattttgctgtgacaggggtttccctgatg
cagactttgattgatgatattttgacctacgccaaggtagatacccagtatgcccaacta
actttcaccgatgtgcaagaagtggtggacaaagctctggctaacctgaagcaacggatt
gaagaaagtggagcagaaattgaagtgggttccatgcccgcagtaatggcggatcaaatt
cagctcatgcaggtattccagaacctgatcgccaatggcatcaagtttgccggggacaag
tcacccaaaattaaaatctggggcgatcgccaggaggatgcctgggtgtttgcggtccaa
gacaacggcattggcattgacccccaattcttcgagcggatttttgtcattttccaacga
ctccacaccagggatgaatataaaggcaccggcatggggctagccatttgcaaaaaaatc
atcgaaggccaccaagggcaaatttggctagagtccaacccaggggagggctccacattc
tacttctccatccccattggcaactaa

DBGET integrated database retrieval system