KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2346Help
Entry
SYNGTS_2346       CDS       T02098                                 

Gene name
uvrB
Definition
(GenBank) excinuclease ABC subunit B
  KO
K03702  
excinuclease ABC subunit B
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:syy00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    SYNGTS_2346 (uvrB)
DNA repair and recombination proteins [BR:syy03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SYNGTS_2346 (uvrB)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      SYNGTS_2346 (uvrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2609523..2611532)
Genome map
AA seq 669 aa AA seqDB search
MTSDLFSLHAPFRPTGDQPTAIASLIESLQGEHKFQTLLGATGTGKTFTMASVIAELGRP
TLVLAHNKTLAAQLCNELRQFFPENAVEYFISYYDYYQPEAYIPVTDTYIEKTASINDEI
DMLRHSATRSLFERRDVIVVASISCIYGLGIPSQYLKAAVPLQVGAEYDPRLVIRDLVNV
QYSRNDVELQRGRFRLKGDVLEIVPAYEDRVIRIEFFGDEVEALRLIDPVSGEILQSLDR
ISIYPARHFVTPEETLEKACQQIQTEMEQQVAFLEKNNLLVEAQRLSQRTRYDLEMLREV
GYCNGVENYSRYLADRQAGEPPECLVDYFPEDWLLVIDESHVTIPQLRGMYNGDQARKKV
LIDHGFRLPSAADNRPLKAEEFWQKVKQCVFVSATPGVWEIEQSEARVIEQVIRPTGVLD
PEIFVRPTTGQVDDLYGEIQTRVKLKERVLITTLTKRMAEDLTDYFSERGIKVQYLHSEI
QSIQRIEILQALRDGEFDVLIGVNLLREGLDLPEVSLVAIMDADKEGFLRAERSLIQTIG
RAARHIRGQAILYADNFTDSMQKAIAETERRRKIQQEYNEKHGITPQPINKRANNAILQF
LDISRRLNSQQLEEVYEQAQDLPLEKIPDLIQQLEEKMQEAAKKQEFEVAAIYRDRIQHL
RDRLLGHKK
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgacctcttttccctccatgcgccctttcgtcctaccggagatcaacccacg
gcgatcgccagtttgatcgagtctttgcagggagagcacaagtttcaaaccctgctgggg
gcaacgggaacggggaaaaccttcaccatggcttcggttattgcggagttgggacgacca
acattggtattagcccacaataaaaccttggcggcccaattatgtaatgaattgcggcaa
ttttttcccgaaaacgcggttgaatacttcattagttattacgactattaccagccagaa
gcctatattcccgtcaccgatacctatatcgaaaaaacggcttctatcaacgatgagatt
gatatgttgcgtcactccgccacccgttctctgtttgaacgacgggatgtaattgtggta
gcttccatcagttgcatttacggtttgggtattcccagccaatatctcaaagcggccgtt
cctctgcaagtgggtgccgaatatgatccccgcctagtaattcgggatttggtcaatgtg
caatatagccgcaacgatgtggaattacaacggggacgatttcgcctcaaaggagatgtg
ttggaaattgtgccggcctatgaagatcgggtgattcgcatcgaattttttggtgacgaa
gtggaagctctacggttaattgatccggtcagcggcgaaattttgcaaagtttagacaga
atcagcatttatcccgcccgtcactttgtcaccccagaagaaaccctagaaaaagcctgt
cagcaaattcaaacggaaatggaacaacaggtagcttttttagaaaaaaataatctgttg
gtagaagctcaaagattaagtcaacgcacccgttatgacttggaaatgctccgagaagtg
ggctattgcaacggagtagaaaattattcccgctatctagccgatcgccaggcgggggaa
ccaccggaatgtttagtggattattttcccgaagattggttattagtaattgatgaatcc
catgtgactattccccaattgcggggtatgtataatggcgaccaggccagaaaaaaagtt
ttaattgaccatggctttcgtctgcccagtgcggcggataatcgccccctaaaagcagaa
gaattttggcaaaaagttaaacagtgtgtgtttgtttctgccactccgggagtttgggaa
atagagcaatcggaagcaagggtaattgagcaggtaattcgccccactggagttcttgat
ccggaaatttttgtccgtcccaccaccggccaggtggatgatttatacggggaaattcaa
accagggtaaagctgaaagaacgggtattaatcacaactttaactaaacggatggcggag
gatttaaccgattatttttctgaacggggcatcaaggttcaatatctccattccgagatt
caatctattcaacgtattgagattttacaagctttacgagacggggaatttgatgtgtta
attggggtaaatttattgcgggaagggttagatttaccggaagtttccctagtagctatt
atggatgcagataaagaaggctttttgcgggcagagcgttctttaattcaaaccattggc
cgggccgcccgtcatattcggggacaggcgattttatatgctgataatttcaccgacagt
atgcaaaaggcaatcgccgaaacggaaaggaggcggaaaatccaacaagaatataacgaa
aagcacggtattacccctcaaccgattaataaacgggctaacaatgccattttgcaattt
cttgatatttcccgtcgtttaaacagtcaacagttggaggaagtatatgaacaagcccag
gatttacccctagaaaaaatccccgatttaattcaacaattggaggaaaaaatgcaagaa
gcggccaaaaaacaggaatttgaagtagctgccatctaccgagaccgcattcaacatttg
cgtgatcggcttttgggccacaaaaagtaa

DBGET integrated database retrieval system