KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2874Help
Entry
SYNGTS_2874       CDS       T02098                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy00260  Glycine, serine and threonine metabolism
syy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syy01100  Metabolic pathways
syy01110  Biosynthesis of secondary metabolites
syy01130  Biosynthesis of antibiotics
syy01230  Biosynthesis of amino acids
Module
syy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYNGTS_2874 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYNGTS_2874 (trpB)
Enzymes [BR:syy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SYNGTS_2874 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAK51622
Position
3212089..3213327
Genome map
AA seq 412 aa AA seqDB search
MNITSPLSAPSHQYPDALGRFGNYGGKYVPETLMPALTELEEAYYRYRAESSFQEELAGL
LKDYVGRSSPLYFAERLSAHYARPDGTYPLIYLKREDLNHTGAHKINNALGQVLLAKRMG
KKRIIAETGAGQHGVATATVCARFGLECIIYMGVQDMERQKLNVFRMNLLGARVQPVTAG
TGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHRVIGQETRQQALKKWGG
LPDILLACVGGGSNAMGLFYDFIDEPAVRLIGIEAAGESIVSGKHAATLTMGKPGVLHGA
MSYLLQDKEGQVTEAHSISAGLDYPGVGPEHSYLKDAGRAEYYSVTDQEAITALQRLSQL
EGIIPALETAHAFAYLETLCPQLKNGERIVINCSGRGDKDVQTVAKYLQMEI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaacattacttcccctctttctgcccctagtcatcagtatcccgacgccctgggtcgt
tttggcaattatggcggcaaatatgtgcctgaaactttaatgccggctctgacggagttg
gaggaagcttactatcgctaccgggcggagagttcctttcaggaagagttagcggggtta
ttaaaagactatgtgggccgttcctctcccctatattttgcggaaagattaagcgcccat
tacgcccgtcccgacggaacctatcctttgatttacctcaaacgagaagatttaaaccat
acgggggcccacaaaattaataacgccctgggccaggttctccttgccaaacgcatgggg
aaaaagcggatcattgccgaaactggtgctggtcaacacggggtggcaacggctacggtg
tgtgctcgctttggcttggaatgcatcatctacatgggggtgcaggatatggagcggcaa
aagctgaatgtctttcgcatgaatttgctgggggccagggtgcaaccagtcacagcgggc
actggaaccctcaaggatgctacctctgaagcaatccgggattgggtcaccaatgtggaa
actacccattacattcttggctctgtggccggaccccatccttaccccatgatggtgcgg
gacttccaccgggtcattggccaggaaactcgccaacaggcattgaaaaaatggggcggt
ctgccggatatcttgctggcttgtgtggggggcggctccaacgccatggggctgttctac
gatttcattgatgagccagcagtgcggttaattggtatcgaagcggcaggggaaagcatt
gtctccggtaagcatgcggccactttaaccatgggtaaaccgggggtgttacatggggcc
atgagttatttactccaggataaggagggtcaagtaacggaagcccattccattagtgct
ggtttagattatcccggtgtgggcccagaacatagctatctcaaggatgcgggacgggca
gaatattacagtgtcaccgaccaagaggcgatcaccgctttgcagagattatcgcaattg
gaaggaattattcctgctctggaaactgcccatgcctttgcctacctagagactctctgc
ccgcaactgaaaaatggcgagcggattgtgatcaactgctccggccgcggggataaggac
gtacaaacggtggctaaatatctccagatggaaatttaa

DBGET integrated database retrieval system