KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2900Help
Entry
SYNGTS_2900       CDS       T02098                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syy01100  Metabolic pathways
syy01110  Biosynthesis of secondary metabolites
syy01130  Biosynthesis of antibiotics
syy01230  Biosynthesis of amino acids
Module
syy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYNGTS_2900 (trpC)
Enzymes [BR:syy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SYNGTS_2900 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth ThiG
Motif
Other DBs
NCBI-ProteinID: BAK51648
Position
3238998..3239885
Genome map
AA seq 295 aa AA seqDB search
MEIRRRPPNPPIKVDILQYQIKHPEAAPRHILEEIVWHKEKEVAQRRELVPLVKLQSLVK
DMTPPLDFVGALRQSPRQPALIAEVKKASPSKGIIRADFDPVAIAKAYEAGGANCLSVLT
DEKFFQGSFENLQLVRSAVQLPLLCKEFIIYPYQIYLARSRGADAVLLIAAILSDKDLRY
FLKIIEGLGMAALVEVHTLEEMDRVLALDGVQLIGVNNRNLQTFTVDLQTTEDLFAQRRE
QLTQGDITLVSESGIYELADLQRLQQAGARAVLVGESLVKQPDPQQAIAALYGEV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcgccgccggcctcctaacccccccatcaaagttgacattcttcagtatcaa
attaagcatccagaagcggctccccgtcacattctggaggaaattgtttggcataaggaa
aaggaagtggcccaacggcgagaattagtccccctggtcaaactccaaagtttagtcaag
gacatgactcccccattggattttgtgggggcattgcgccagagtccccggcaaccggcc
ttaattgctgaagtgaaaaaggcttcccctagtaagggcattattcgggcggattttgac
ccagtggcgatcgccaaggcctatgaagcgggaggggctaactgtttatcggtgttgacg
gacgagaaatttttccagggtagttttgaaaatttgcaactggtacgctcagcggtgcaa
ttacccttgctgtgcaaggaatttattatttacccctatcaaatctatctagcccggagt
cggggggccgatgcggtgctgttaattgccgctatcctcagcgataaggatttgcgttat
ttcctcaaaattattgaaggtttgggcatggcggcgttggtggaagtccataccctggag
gaaatggaccgggttttggctttggacggggtgcaactaatcggagttaataaccgtaat
ttgcaaaccttcaccgttgatctgcaaaccacagaggatctttttgcccaacgacgggag
caattaacccaaggggacattactttagtgagcgaatccggcatttatgaattggctgat
ttgcaaagattacagcaggctggggcccgggccgttttagtcggcgaatccctggtcaaa
caaccagatccccaacaggcgatcgccgctttatacggtgaagtttaa

DBGET integrated database retrieval system