KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2900Help
Entry
SYNGTS_2900       CDS       T02098                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYNGTS_2900 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYNGTS_2900 (trpC)
Enzymes [BR:syy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SYNGTS_2900 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3238998..3239885
Genome map
AA seq 295 aa AA seqDB search
MEIRRRPPNPPIKVDILQYQIKHPEAAPRHILEEIVWHKEKEVAQRRELVPLVKLQSLVK
DMTPPLDFVGALRQSPRQPALIAEVKKASPSKGIIRADFDPVAIAKAYEAGGANCLSVLT
DEKFFQGSFENLQLVRSAVQLPLLCKEFIIYPYQIYLARSRGADAVLLIAAILSDKDLRY
FLKIIEGLGMAALVEVHTLEEMDRVLALDGVQLIGVNNRNLQTFTVDLQTTEDLFAQRRE
QLTQGDITLVSESGIYELADLQRLQQAGARAVLVGESLVKQPDPQQAIAALYGEV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcgccgccggcctcctaacccccccatcaaagttgacattcttcagtatcaa
attaagcatccagaagcggctccccgtcacattctggaggaaattgtttggcataaggaa
aaggaagtggcccaacggcgagaattagtccccctggtcaaactccaaagtttagtcaag
gacatgactcccccattggattttgtgggggcattgcgccagagtccccggcaaccggcc
ttaattgctgaagtgaaaaaggcttcccctagtaagggcattattcgggcggattttgac
ccagtggcgatcgccaaggcctatgaagcgggaggggctaactgtttatcggtgttgacg
gacgagaaatttttccagggtagttttgaaaatttgcaactggtacgctcagcggtgcaa
ttacccttgctgtgcaaggaatttattatttacccctatcaaatctatctagcccggagt
cggggggccgatgcggtgctgttaattgccgctatcctcagcgataaggatttgcgttat
ttcctcaaaattattgaaggtttgggcatggcggcgttggtggaagtccataccctggag
gaaatggaccgggttttggctttggacggggtgcaactaatcggagttaataaccgtaat
ttgcaaaccttcaccgttgatctgcaaaccacagaggatctttttgcccaacgacgggag
caattaacccaaggggacattactttagtgagcgaatccggcatttatgaattggctgat
ttgcaaagattacagcaggctggggcccgggccgttttagtcggcgaatccctggtcaaa
caaccagatccccaacaggcgatcgccgctttatacggtgaagtttaa

DBGET integrated database retrieval system