KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2929Help
Entry
SYNGTS_2929       CDS       T02098                                 

Gene name
gap2
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase (NADP+)(phosphorylating)
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYNGTS_2929 (gap2)
   01230 Biosynthesis of amino acids
    SYNGTS_2929 (gap2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNGTS_2929 (gap2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNGTS_2929 (gap2)
Enzymes [BR:syy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     SYNGTS_2929 (gap2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3276938..3277951)
Genome map
AA seq 337 aa AA seqDB search
MTRVAINGFGRIGRNFLRCWLGRTDSQLEVVGINDTSDPRTNAHLLRYDSMLGKLDADIS
ADENSITVNGKTIKCVSDRNPLNLPWAEWNVDLVIEATGVFVTHEGATKHVQAGAKKVLI
TAPGKGPNIGTYVVGVNAHEYKHEEYEVISNASCTTNCLAPIAKVINDNFGIIKGTMTTT
HSYTGDQRILDASHRDLRRARAAAVNIVPTSTGAAKAVALVIPELQGKLNGIALRVPTPN
VSVVDLVVQVEKNTIAEQVNGVLKEAANTSLKGVLEYTDLELVSSDFRGTDCSSTVDGSL
TMVMGGDMVKVIAWYDNEWGYSQRVVDLAEIVAKNWK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgactagagtagcaattaacggatttggacggatcggacgcaactttctccgttgctgg
ctggggcgcaccgatagccagttagaagtagtcggtatcaacgacacctctgatcccaga
accaatgctcaccttttgcgctacgactccatgttgggtaagttggatgcggacatcagt
gccgacgaaaactccattaccgtcaatggcaagactattaaatgtgtttccgaccggaat
cccctcaatttgccctgggcagaatggaatgtagatctagtcatcgaagccaccggtgtt
tttgttacccatgaaggggccaccaagcacgttcaagccggagccaaaaaagttttaatc
actgctcctggcaaggggcccaacatcggcacctatgtggtgggggtcaatgcccacgaa
tataagcacgaagaatacgaagtaattagtaacgctagttgtactaccaactgcctcgcc
ccgatcgccaaagtaatcaacgacaattttggcatcatcaaaggcaccatgaccaccacc
cacagctacaccggagaccaacggatcctcgatgctagccaccgggatctacgccgggcc
cgggctgctgccgttaacatcgtgcccacctccaccggagctgccaaagcggtggccctg
gtaattcctgaactgcaaggcaaattgaacggtattgccctgcgggtgcccacccccaac
gtttccgtggtggatttggtagtacaagtagagaaaaacaccatcgctgaacaggttaac
ggagtgctcaaagaagcagccaacaccagccttaaaggagtgttggaatacaccgatttg
gaattggtttccagcgacttccggggcacggattgctcttccactgtggatggtagtctg
accatggtaatgggcggtgacatggttaaagtcattgcttggtacgacaacgaatggggc
tattcccaacgggtggtggacttggctgaaattgtggctaaaaactggaaatag

DBGET integrated database retrieval system