KEGG   Synechocystis sp. PCC 6803: MYO_120370Help
Entry
MYO_120370        CDS       T02468                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
syz  Synechocystis sp. PCC 6803
Pathway
syz00521  Streptomycin biosynthesis
syz00523  Polyketide sugar unit biosynthesis
syz01130  Biosynthesis of antibiotics
Module
syz_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:syz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MYO_120370 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MYO_120370 (rfbC)
Enzymes [BR:syz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     MYO_120370 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-GeneID: 14617459
NCBI-ProteinID: AGF52278
Position
2225096..2225644
Genome map
AA seq 182 aa AA seqDB search
MNVIPTTIADVLILEPKVFGDERGFFFESYNDKVFQQAVGIEPHFVQDNHSFSRQGVVRG
LHYQIQHPQGKLVRVARGEIFDVAVDLRRNSPSFGQWVGCVLNDHNKRQLWIPAGFAHGF
AVLSPEAEVLYKATDYYAPSYERTLLWNDPAIGIDWSLTTTPLLSLKDQRGLPLAEAEVF
DF
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtgattcccacaactatcgccgatgtgttgattttggagcccaaagtctttggc
gatgaacggggttttttctttgagagctacaacgacaaggttttccagcaggcagtgggc
atagaaccccattttgtgcaggacaatcattccttttctcgtcagggggtagtgcggggg
ttacattatcaaatccagcatccccagggaaaattagttcgggtggcccggggagaaatt
tttgatgtggcagtggatctgcgccgtaattcccctagttttggccagtgggtgggttgt
gtgctcaatgaccacaataaaagacagctatggattcccgccggttttgcccacggtttc
gccgttctttccccggaggcagaggtgctgtataaagcaacggattactatgcaccgtcc
tatgagcgcaccctattgtggaatgacccggccattggcattgattggtcgttaaccacc
actcccctattatctctcaaggatcaacggggtcttcccctagccgaagcggaggtgttt
gatttttaa

DBGET integrated database retrieval system