KEGG   Synechocystis sp. PCC 6803: MYO_124680Help
Entry
MYO_124680        CDS       T02468                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
syz  Synechocystis sp. PCC 6803
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYO_124680 (folE)
Enzymes [BR:syz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MYO_124680 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2715318..2716022
Genome map
AA seq 234 aa AA seqDB search
MTIASSHSINNGMNTGKLVNQLSSLPDRNTHNGQEVKYHPENVELNKEKMMDAVRVMLES
VGEDPEREGLLKTPKRVAEAMQFLTQGYDQSLEKLVNGAIFDEGHNEMVLVRDIDFFSLC
EHHMLPFMGKAHLAYIPNQKVVGLSKLARIVEMFSRRLQVQERLTRQIAEAVQEILDPQG
VAVVMEATHMCMVMRGVQKPGSWTVTSAMIGSFQNEQKTREEFLNLIRHQPNFY
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
gtgaccattgcttcttcccattccatcaataacggcatgaacaccggtaaattagtgaat
cagctttcctccctacctgaccgtaatacccacaatgggcaagaggtgaaatatcatccc
gaaaatgttgagttgaataaagaaaaaatgatggacgcggtgcgcgtcatgttggagtca
gtaggggaagatccggaaagggaaggcttgctaaaaacccccaaacgggtagcagaagca
atgcaatttttgacccagggttatgaccaatccttggaaaaattagtcaatggcgccatt
tttgacgaaggtcataacgaaatggtattggtgcgggacattgattttttcagtttgtgt
gaacatcacatgttgccctttatgggtaaggcccatttggcttatattcccaaccaaaaa
gtagtgggactgagcaaactggcccgcatcgtggaaatgttttcccgccgtctccaggta
caggagcgtctcaccaggcagatcgccgaagcagtacaggaaatcctcgatccccaaggt
gtggcagtggtgatggaagccacccacatgtgcatggtaatgcgtggtgtacaaaaacca
ggttcctggacagtgaccagtgccatgattggttctttccaaaatgaacaaaaaaccaga
gaagagtttttgaacctgattcgccatcaacctaatttctattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system