KEGG   Synechocystis sp. PCC 6803: MYO_125090Help
Entry
MYO_125090        CDS       T02468                                 

Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
syz  Synechocystis sp. PCC 6803
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYO_125090
Enzymes [BR:syz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MYO_125090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2762822..2766034
Genome map
AA seq 1070 aa AA seqDB search
MNSILSPITVAVGGSLWWNGFTADFTITNTSTTSLSNWTYTFDTVHKISGNPWGATFTSV
DLGNGITRYTLTGAGWASSIPPGGSVTIGFNGTQGTAIGNSGSLTSALLFTDVNANTGGT
GGEHQHPDPIPPTDPVVDPTPNPGTGRVFAANPAAADIVGFNPAVDRLDFGDVSVHNLIL
GKTSTGKVAIINPWAWTPEFQIIRGVSFDDLTAANFGIVQNEHLRQDIGGVLSWELGLGA
RNSNTVYVRSHEYGVQERIENFNPATMKLSFLYYGTRERLTVSDTPEGLLIATQPTGQTL
LLVGVTRSQLIPANLEFHHDQVVEDRLEDAFGVTVEQVTVVSRTGLATPQGPAGQITDGH
QSRPGNGLTPIGGGEFSGGAGGHGSGHDHGDHDHGGGMDHGSDPGDGMGGGTTNPPVTDP
VTPPPTDPVSPTSPFTVTVGGNRWWNGFTAELTVTNVSGTKLNSWSFTFDTVHKISGSPW
GATVQSTDLGGGITRYVVTGSEWAASIAPGSSVKVGFNGTQGTAIANDGALTADLLFLGG
GIVGQPSTGSGGNTGGTPTNPNPPTDPINPNPNPVDPVDPPAIANGDHNYGEALQKSFLF
YEANRSGDLDESTKRIDWRGDSGLRDGRDGIYFGGQSSGNLQAGLSLDLTGGYHDAGDHG
KFGLPLASTLTTLAWGGVEFTDGYQTSGQMDDLLATIRWGTDYLLKAHVTNANGETVFFV
AQVGNASADHSLWSAPESQTIARPAMAVTANKPGSDVAAGSAAALAAASILFREAGDFAY
ADELLVNAQSLYRFADTYRGKYSDSIPEVRNYYNSWSGYEDELAYGAAWLSRAVNSAGGD
GSAYLQKALNIYNSDIGGLSRGWTHNWDDASYGVAVILAQDTGNQAIKQDVTRWLDAWVN
GTDGVQITDGGLRFISQWGSLRYAANTAMLAAVYSDGLTDPTGKYAQLAQDTVDYILGSN
PRNASYMVGYGNDFPQQPHHRAASGVGWDGFRNGLPNEHILFGALVGGPTAANDFSYNDS
RDDYISNEVAIDYNAGLTGALAWSVEQFGGNPLTAAQLNALPGISAPQGM
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcatcctttcccccattaccgtagcggtgggcggctccctctggtggaatggc
ttcaccgctgatttcaccatcaccaacacttctaccactagcctcagcaattggacttac
accttcgacactgtccacaaaatttccggtaatccctggggcgcaacttttaccagcgtg
gatttgggcaatggcatcacccgctacacattaactggggctggttgggcatcgagtatt
ccccccggtggttccgtcaccattggttttaatggtacccagggaacggcgatcggtaat
agcggctctttgacttctgctttattattcaccgacgttaatgccaatactggggggact
gggggagaacatcagcatccagatcctattcctcccacggatccagtcgtagatcccact
cctaaccccggcactggtagagtatttgctgccaatcctgcggccgccgatattgtcggt
ttcaatcccgctgtggataggttggattttggcgatgtgtcggtgcataacctcatcctt
ggtaaaaccagcaccgggaaagtggccatcattaatccctgggcttggactcctgagttt
cagattatccggggagttagctttgatgatttgacagcggccaattttggcattgtgcag
aacgagcatctgcggcaggacattggcggagtcctcagttgggaattaggtttaggggca
agaaatagtaatacggtttatgtccgttcccatgagtatggggtgcaggaacggatcgag
aattttaaccccgccaccatgaagttgagctttctctactacggcactagggaaagatta
accgttagcgatacgccggagggtttattaattgccacccaacccacgggacaaactttg
ttgctggtgggggtaacccgcagtcaactcattccggctaatttggaatttcaccatgac
caggtggtggaagaccgcttagaagatgcctttggggtcactgtcgagcaagttaccgtt
gttagtcgcactggtttagccactccccaggggccagcgggacaaattaccgatggtcat
cagagcaggcccggtaatggtttaactcccattggtggtggggaatttagcggcggtgct
gggggtcatggtagtggccatgatcacggtgaccatgaccatggcggcggtatggaccac
ggttctgatcccggtgatggcatggggggaggcactaccaatcctccggtcaccgatcca
gtcacgcccccacccaccgatcctgtttctcccactagtcctttcactgtcacggtggga
ggtaatcgttggtggaatggctttacggcggagttgactgtaactaacgtttcgggaact
aagcttaatagctggagctttacctttgatacggtgcataaaatttccggtagcccctgg
ggagccactgtccaaagtacagatttaggaggaggcattacccgttatgtggtcaccggc
agtgaatgggccgcttccattgcccctggcagttcggtcaaagttggctttaacggtacc
caaggaacggcgatcgccaacgacggggccttaaccgcagatttactctttctcggtggc
ggtatagttggtcaacccagcactggctctggtggtaatactggaggaactcccactaat
cccaatccccccactgaccccattaatcctaaccccaatcctgttgatcccgtcgatccc
ccggcgatcgccaatggggaccataattacggcgaagcgttgcaaaaatctttcctgttt
tacgaagccaaccgttctggagacttagacgaatccactaaacgcattgactggcgggga
gattccgggttaagggatggccgggatggcatttattttggtggacaaagtagcggtaat
ttacaagcaggtttaagcctggatttaaccggtggttatcatgatgcgggggaccacggc
aaatttggcttaccccttgcttccacattaaccaccctggcctggggcggcgtggaattt
acggacggttaccaaaccagtggccaaatggatgatctccttgcaaccatacggtggggg
acggactatctactcaaagctcacgttaccaacgccaatggagagacagtattttttgtc
gcccaggtgggtaacgcttcagcagatcattccctctggagtgccccggaaagccaaacc
attgcccggccagccatggcggttactgctaataaacctggttccgatgtggcggcgggt
tcagcggcggccctggcggcggcttctattctgttccgagaagcgggggattttgcctat
gcggatgaattgttagtcaatgcccaatctttatatcgatttgcggacacctaccggggt
aaatattccgactctattcccgaagtgcggaactattacaactcctggagtggctatgaa
gatgagttggcctatggggcagcgtggttgtcccgggcggttaatagtgcagggggggat
ggttctgcctatctgcaaaaggcattgaacatttacaacagtgacattgggggattgagt
cggggttggacccacaattgggacgatgcctcctatggtgtggcggtaatattagcccaa
gacaccggtaatcaagcgattaaacaagatgtgacccgctggctagatgcttgggtcaat
ggcaccgatggggtgcaaatcactgacggcggtttgcggtttattagccaatggggttcc
ctacgctacgcggccaatacggcaatgctggcagcggtctattccgacggcttaaccgat
cccactggtaagtatgcccagttagcccaggacacagtggactatattttaggcagtaat
ccccgcaatgctagctatatggtgggttacggcaatgattttccccaacagccccaccat
cgggcagcttcgggagtgggctgggacggtttccgcaacggcttgcccaatgagcatatt
ttgttcggtgctttggtgggcggtcccactgcggccaatgactttagttataacgactcc
cgggatgactacatcagcaacgaagtggccattgattacaatgcaggcttaacgggagca
ttggcttggtcggtggaacagtttgggggtaatcccctcacggcggcccagttgaatgct
ttacctggtatttcagcgccccaagggatgtag

DBGET integrated database retrieval system