KEGG   Synechocystis sp. PCC 6803: MYO_125630Help
Entry
MYO_125630        CDS       T02468                                 

Gene name
desC(des9)
Definition
acyl-CoA desaturase 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
syz  Synechocystis sp. PCC 6803
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:syz00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MYO_125630 (desC(des9))
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MYO_125630 (desC(des9))
Enzymes [BR:syz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     MYO_125630 (desC(des9))
Lipid biosynthesis proteins [BR:syz01004]
 Desaturase
  First
   MYO_125630 (desC(des9))
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2819847..2820803)
Genome map
AA seq 318 aa AA seqDB search
MLNPLNIEYLYLSKLFDNSLIVFNKRQLFRFFVRFFFMTAALPNDSKPKLTPAWTVIFFF
TSIHLVALLAFLPQFFSWKAVGMAFLLYVITGGIGITLGFHRCISHRSFNVPKWLEYIFV
ICGTLACQGGVFEWVGLHRMHHKFSDTTPDPHDSNKGFWWSHIGWMMFEIPAKADIPRYT
KDIQDDKFYQFCQNNLILIQVALGLILFALGGWPFVIWGIFVRLVFVFHFTWFVNSATHK
FGYVSHESNDYSRNCWWVALLTFGEGWHNNHHAYQYSARHGLQWWEVDLTWMTIKFLSLL
GLAKDIKLPPETAMANKA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacccattaaacattgaatacctatatttaagcaaactttttgacaatagttta
atcgtttttaacaagcgccaattattccgttttttcgttaggttttttttcatgactgct
gctcttcccaacgattccaagcccaagttgactccagcttggactgtgatcttctttttt
acctccattcatttggtggccctgttggctttcctgccccagtttttcagttggaaagca
gtggggatggctttcttgctctatgtaattaccggcggcattggcattactttaggtttt
caccgttgtatttcccaccgcagtttcaatgttcctaaatggttagagtatattttcgta
atctgtggcaccctagcctgtcaggggggcgtatttgagtgggtcggcttacaccgtatg
caccacaaattttctgacaccaccccggatccccacgattctaataagggtttttggtgg
agtcacatcggctggatgatgtttgaaattcctgctaaagctgatattccccgctacacc
aaggatatccaagacgataaattttatcaattttgccagaataatctaattcttatccag
gtcgccctaggcttgattttatttgccttagggggctggcccttcgttatttggggcatt
tttgtccgcctagtgtttgttttccacttcacttggtttgtcaacagtgccacccataag
ttcggctacgttagccatgaatccaatgattattcccgcaattgttggtgggtagcattg
ttaactttcggtgaaggttggcacaataatcaccacgcctatcagtactctgctcgccat
ggtttgcaatggtgggaagtggatttaacttggatgaccattaaattcctatctttgctg
gggttagccaaggatattaaacttcctccggaaactgcgatggccaacaaagcctag

DBGET integrated database retrieval system