KEGG   Thermoplasma acidophilum: Ta0897Help
Entry
Ta0897            CDS       T00037                                 

Definition
glucose 1-dehydrogenase
Orthology
K18124  
glucose/galactose 1-dehydrogenase (NADP+) [EC:1.1.1.360]
Organism
tac  Thermoplasma acidophilum
Pathway
Pentose phosphate pathway
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ta0897
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ta0897
   00052 Galactose metabolism
    Ta0897
Enzymes [BR:tac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.360  glucose/galactose 1-dehydrogenase
     Ta0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
966009..967094
Genome map
AA seq 361 aa AA seqDB search
MTEQKAIVTDAPKGGVKYTTIDMPEPEHYDAKLSPVYIGICGTDRGEVAGALSFTYNPEG
ENFLVLGHEALLRVDDARDNGYIKKGDLVVPLVRRPGKCINCRIGRQDNCSIGDPDKHEA
GITGLHGFMRDVIYDDIEYLVKVEDPELGRIAVLTEPLKNVMKAFEVFDVVSKRSIFFGD
DSTLIGKRMVIIGSGSEAFLYSFAGVDRGFDVTMVNRHDETENKLKIMDEFGVKFANYLK
DMPEKIDLLVDTSGDPTTTFKFLRKVNNNGVVILFGTNGKAPGYPVDGEDIDYIVERNIT
IAGSVDAAKIHYVQALQSLSNWNRRHPDAMKSIITYEAKPSETNIFFQKPHGEIKTVIKW
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacagaaagccattgtgacagatgcgcccaaaggtggcgtgaaatacacaaca
atagacatgcctgaaccggaacattacgacgccaagctttcacctgtatacataggaata
tgcggaacggatcgtggagaggtggctggtgccctgtcattcacgtacaatccagagggg
gagaattttcttgttctcgggcacgaggcgcttctgcgtgttgacgatgcccgtgataat
ggctacataaagaagggcgatcttgtagtacccctcgtgagaaggcctggaaaatgcatc
aactgcagaataggcaggcaggataactgttccataggtgatccggacaaacatgaggct
ggaataactgggcttcatggtttcatgcgcgatgtcatatacgacgatatagagtatctc
gttaaggttgaagatccagaactgggaaggatcgcagtgcttacggagcctctgaaaaat
gtcatgaaggcttttgaggtcttcgacgttgtgtcaaaaagatccatattcttcggggac
gattccacgctcataggtaagaggatggtcataataggcagcgggagcgaggctttcctc
tactcgtttgcaggcgtagatcgcggtttcgacgtcacaatggtgaacaggcacgatgag
acggaaaacaagctgaagatcatggacgagttcggcgtcaagttcgcaaactaccttaag
gacatgccggaaaagatagatctcctggttgacaccagtggtgatccaacgacgacattc
aagttcctcaggaaggtaaacaacaacggcgtcgtcatattgttcggcacgaacggcaag
gcgcccggctatccagtggatggcgaggacatagattacatcgtggagaggaacataaca
atagccggatcggttgatgccgcgaagatacactacgtgcaggcccttcagtccctcagc
aactggaacagaagacacccagatgccatgaagagcatcataacatacgaggcgaagccg
tccgaaaccaacatattcttccagaaaccacacggagagataaagacggtgataaagtgg
cagtga

DBGET integrated database retrieval system